Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q96LR1 C9JG53
Symbols C17orf69
MGC57346

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MHPWLGSALGFPKCRGIHLCACGNGWTPGETLSQNKTEITKNKVTCWRPHGCEPNTGLGYQGSHTSKYTL      1 - 70
LPWNLLKTKPLPPSHGKEGGKEAKVPSGDNSGRGEVPRAQEGQAACGRAASGDSQEGMRRGYEERATAQR     71 - 140
PAVRSAETTAHGTWIYP                                                         141 - 157
//

Text Mined References (8)

PMID Year Title
21292315 2011 Imputation of sequence variants for identification of genetic risks for Parkinson's disease: a meta-analysis of genome-wide association studies.
19915575 2009 Genome-wide association study reveals genetic risk underlying Parkinson's disease.
19416867 2009 The transcriptome of human CD34+ hematopoietic stem-progenitor cells.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.