Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
lung carcinoma 1.600 5.7e-18
nasopharyngeal carcinoma -1.100 6.9e-08
pituitary cancer 1.200 1.4e-04
posterior fossa group B ependymoma 2.000 3.5e-07
subependymal giant cell astrocytoma 1.142 3.0e-02

AA Sequence

MYRVPEFYARRKRLGGQTPYLMDQLGLRLGMWYWKDETRTLEFRRFAAEDSVQWLLKHHPHFTPAAEVKE      1 - 70
KGKKGKAVHFAETDGPASDRLTDKRLAAKDDKSAKAVEKRGQQGTITLDDVKFVTLLLLQDTEMQRICSF     71 - 140
TTFMRNKNLDNFLMALLYYLSHYLEKNSLEKKPKSYMVGLVEKKEMELVLSELEAAQRYLAQKYCILVLG    141 - 210
LAVPDKHHMCCGKEKISDTQKDWKFFESFYTFCTYVAWIVFRRQHLTEIEEEVGRLFRTNMFNIPRRRRE    211 - 280
DEESGGEKKRMTFVQFRRMMAKRPAIKKAINMRSPVMSTLLPSLREKAQNVFEKKYHQVDVRFPAEMQKH    281 - 350
VGTLDSVPMPVVGILGEPRCLFNPHTLHPLDPEENTKSFGRYPSLMENNNMRIQDTLDLVMKTLSSHTSC    351 - 420
PK                                                                        421 - 422
//

Text Mined References (4)

PMID Year Title