Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
nasopharyngeal carcinoma 1058 8.8e-08
psoriasis 6694 1.6e-04
non-small cell lung cancer 2890 1.7e-04
pituitary cancer 1972 1.4e-02
Pick disease 1894 3.0e-02
Endometriosis 540 3.2e-02
ependymoma 4679 4.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (7)

Disease log2 FC p
Endometriosis -1.312 3.2e-02
ependymoma 4.700 4.0e-02
nasopharyngeal carcinoma -3.700 8.8e-08
non-small cell lung cancer -1.169 1.7e-04
Pick disease 1.700 3.0e-02
pituitary cancer -1.100 1.4e-02
psoriasis -1.100 1.6e-04

Gene RIF (1)

AA Sequence

MQLQFLGTLASSEKRKKSQRLFFKNIKSTKNKAGKASIMSSDTNVNKSASPTATAEEQPVEPDGPLPGSD      1 - 70
NNQEKKVRLSPAKMSTKNSTDLVEYVDKSHAFLPIIPNTQRGQLEDRLNNQARTIAFLLEQAFRIKEDIS     71 - 140
ACLQGTHGFRKEESLARKLLESHIQTITSIVKKLSQNIEILEDQIRARDQAATGTNFAVHEINIKHLQGV    141 - 210
GDLRGRVARCDSSIVKLSGDIHLFRQEHRQIEKAIQEFVPALETLSKNLDMKVMQLLGKIETASPEQTSN    211 - 280
LKMVQGDYRHEMNLLEFKFHSLSSNLYEEVENNKKWTENQFLKYRKDHLGHINECLKVLQEKLEKSENKM    281 - 350
EEKLLQLSSKVENFINTQKQETQLSKVKHMENKLSKKMEQMEKQIWGELETMQNEYQSGFKSIHDSLSSL    351 - 420
QQIQKTKMDLEKYKVQKDLKKLQRKIVELQEV                                          421 - 452
//

Text Mined References (8)

PMID Year Title