Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.63
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma, large-cell 6241 9.8e-05
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 3.0

Gene RIF (1)

AA Sequence

MAGVKYPGQDPVDLDIYQSSHMVDYQPYRKHKYSRVTPQEQAKLDAQLRDKEFYRPIPNPNPKLTDGYPA      1 - 70
FKRPHMTAKDLGLPGFFPSQEHEATREDERKFTSTCHFTYPASHDLHLAQGDPNQVLQSADFPCLVDPKH     71 - 140
QPAAEMAKGYLLLPGCPCLHCHIVKVPILNRWGPLMPFYQ                                  141 - 180
//

Text Mined References (8)

PMID Year Title