Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q96LM1
Symbols C12orf37

Gene

 Compartment GO Term (0)

AA Sequence

MKQKQEVMFQSRGRLSLYIQMSSVYSAKLGPVGGICGQKQKPSFFFFKAQSQDARPLAPAACISKIAKAG      1 - 70
RELPGRHLPGQKTPTLAGRHVPLKIEKEAIVYYVAVMSDWDTSCLQRTIKPLSCPHLGLTPS             71 - 132
//

Text Mined References (2)

PMID Year Title
16541075 2006 The finished DNA sequence of human chromosome 12.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.