Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.10
PubTator Score 0.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 6.5e-04
Disease Target Count Z-score Confidence
Williams-Beuren syndrome 50 5.066 2.5

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.013 6.5e-04

Gene RIF (1)

AA Sequence

MAAMRWRWWQRLLPWRLLQARGFPQNSAPSLGLGARTYSQGDCSYSRTALYDLLGVPSTATQAQIKAAYY      1 - 70
RQCFLYHPDRNSGSAEAAERFTRISQAYVVLGSATLRRKYDRGLLSDEDLRGPGVRPSRTPAPDPGSPRT     71 - 140
PPPTSRTHDGSRASPGANRTMFNFDAFYQAHYGEQLERERRLRARREALRKRQEYRSMKGLRWEDTRDTA    141 - 210
AIFLIFSIFIIIGFYI                                                          211 - 226
//

Text Mined References (8)

PMID Year Title