Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.35
PubTator Score 4.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 7.6e-13
osteosarcoma 7950 5.7e-09
group 3 medulloblastoma 4104 6.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma -1.100 6.7e-03
osteosarcoma 2.515 5.7e-09
ovarian cancer 1.200 7.6e-13

Gene RIF (1)

AA Sequence

MGVTGAHGFPCCGKGSVEVAEMRDDLSQHQIQEEQELEADMLEQKPQLQVDLDLDPDPDPDPELEIGQVP      1 - 70
ALLESELYPALKLEAELDTEANSNEESDFEEPMQLVCKIESVHSNMGLPTPQTFRPWSLNSNCRSFTEEN     71 - 140
HVSACHHSISAQTSKHLFWANKLIQASEHSLQRAINMQLNNGSAGQPIRSPLREAIPTNALCSEEQLQIP    141 - 210
DAHSAPPTTSSQAPSPLLSSDLPPPIDLTELITFASSLAMASSSRMDLPSLEHMMKAPPQEALEPSTEPL    211 - 280
LTTVEEREPENHAETLPEKPREARAPLKSWSQEDKNFAQSYFDFSKPGIKRATIKGQIQLLQPPATSPLL    281 - 350
QGSKEDSVPPGKEKENPLLVKIHFKLSAPTIPEK                                        351 - 384
//

Text Mined References (7)

PMID Year Title