Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.24
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.500 9.3e-03
hepatocellular carcinoma 1.400 1.1e-05
medulloblastoma, large-cell -2.100 4.9e-05
oligodendroglioma -1.600 2.3e-02
osteosarcoma -1.483 6.7e-04
pancreatic cancer 1.200 1.6e-02
pancreatic carcinoma 1.200 1.6e-02
posterior fossa group B ependymoma 1.100 1.3e-03
tuberculosis -1.400 9.0e-05

Gene RIF (3)

AA Sequence

MMCTAKKCGIRFQPPAIILIYESEIKGKIRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKSYLEQVSLRQL      1 - 70
EKLFSFLRGYLSGQSLAETMEQIQRETTIDPEEDLNKLDDKELAKRKSIMDELFEKNQKKKDDPNFVYDI     71 - 140
EVEFPQDDQLQSCGWDTESADEF                                                   141 - 163
//

Text Mined References (14)

PMID Year Title