Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.75
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
hepatocellular carcinoma 1.400 0.000
pancreatic cancer 1.200 0.016
astrocytic glioma -1.500 0.009
oligodendroglioma -1.600 0.023
osteosarcoma -1.483 0.001
medulloblastoma, large-cell -2.100 0.000
tuberculosis and treatment for 6 months -2.100 0.000
posterior fossa group B ependymoma 1.100 0.001
pancreatic carcinoma 1.200 0.016

Synonym

Accession Q96LK0 B2RA74 Q96I48 Cep19
Symbols MOSPGF
C3orf34

Gene

Gene RIF (1)

PMID Text
24268657 loss of the ciliary protein CEP19 in humans and mice causes morbid obesity.

AA Sequence

MMCTAKKCGIRFQPPAIILIYESEIKGKIRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKSYLEQVSLRQL      1 - 70
EKLFSFLRGYLSGQSLAETMEQIQRETTIDPEEDLNKLDDKELAKRKSIMDELFEKNQKKKDDPNFVYDI     71 - 140
EVEFPQDDQLQSCGWDTESADEF                                                   141 - 163
//

Text Mined References (10)

PMID Year Title
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
25416956 2014 A proteome-scale map of the human interactome network.
24268657 2013 Morbid obesity resulting from inactivation of the ciliary protein CEP19 in humans and mice.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.