Disease | Target Count | P-value |
---|---|---|
psoriasis | 6685 | 4.07965862448949E-61 |
posterior fossa group B ependymoma | 1530 | 6.79893758516118E-15 |
nasopharyngeal carcinoma | 1056 | 7.20437178425783E-8 |
intraductal papillary-mucinous carcinoma (IPMC) | 2988 | 3.77879171209543E-4 |
intraductal papillary-mucinous adenoma (IPMA) | 2956 | 3.83700601828054E-4 |
osteosarcoma | 7933 | 5.84475794591688E-4 |
group 3 medulloblastoma | 2254 | 0.00117117981399581 |
intraductal papillary-mucinous neoplasm (IPMN) | 3289 | 0.00222515546813059 |
ductal carcinoma in situ | 1745 | 0.0131584937073847 |
chronic rhinosinusitis | 512 | 0.0294261392364442 |
cystic fibrosis and chronic rhinosinusitis | 213 | 0.0385617016819193 |
Disease | log2 FC | p |
---|---|---|
osteosarcoma | -1.330 | 0.001 |
posterior fossa group B ependymoma | 2.800 | 0.000 |
intraductal papillary-mucinous adenoma (... | 2.900 | 0.000 |
intraductal papillary-mucinous carcinoma... | 2.800 | 0.000 |
intraductal papillary-mucinous neoplasm ... | 3.000 | 0.002 |
group 3 medulloblastoma | -1.200 | 0.001 |
nasopharyngeal carcinoma | -1.900 | 0.000 |
ductal carcinoma in situ | 1.200 | 0.013 |
chronic rhinosinusitis | -1.514 | 0.029 |
cystic fibrosis and chronic rhinosinusit... | -1.631 | 0.039 |
psoriasis | -1.300 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Chicken | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG |
PMID | Text |
---|---|
26389662 | Data show that UBXN10 localizes to cilia in a AAA-ATPase VCP-dependent manner and both VCP and UBXN10 are required for ciliogenesis. |
MATEAPVNIAPPECSTVVSTAVDSLIWQPNSLNMHMIRPKSAKGRTRPSLQKSQGVEVCAHHIPSPPPAI 1 - 70 PYELPSSQKPGACAPKSPNQGASDEIPELQQQVPTGASSSLNKYPVLPSINRKNLEEEAVETVAKKASSL 71 - 140 QLSSIRALYQDETGTMKTSEEDSRARACAVERKFIVRTKKQGSSRAGNLEEPSDQEPRLLLAVRSPTGQR 141 - 210 FVRHFRPTDDLQTIVAVAEQKNKTSYRHCSIETMEVPRRRFSDLTKSLQECRIPHKSVLGISLEDGEGWP 211 - 280 //
PMID | Year | Title |
---|---|---|
26389662 | 2015 | Systematic proteomics of the VCP-UBXD adaptor network identifies a role for UBXN10 in regulating ciliogenesis. |
23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
17207965 | 2007 | hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes. |
16710414 | 2006 | The DNA sequence and biological annotation of human chromosome 1. |
15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. |
12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. |