Property Summary

NCBI Gene PubMed Count 17
PubMed Score 0.43
PubTator Score 1.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -2.500 0.000
esophageal adenocarcinoma -2.000 0.018
psoriasis 1.700 0.000
osteosarcoma -1.354 0.004
adrenocortical carcinoma -1.041 0.000
X-linked cerebral adrenoleukodystrophy -1.100 0.027
pilocytic astrocytoma 1.100 0.000
ovarian cancer 1.400 0.000

Gene RIF (3)

PMID Text
25052469 Data suggest that members of short chain dehydrogenase/reductase superfamily (human DHRS1; E coli galE) exhibit conserved residues and tertiary structure in active site domain that are essential for biocatalysis.
20877624 Observational study of gene-disease association. (HuGE Navigator)
12153138 novel human SDR-type dehydrogenase/reductase gene named Dehydrogenase/reductase (SDR family) member 1 (DHRS1)

AA Sequence

MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESE      1 - 70
VRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVP     71 - 140
AGQGLIVVISSPGSLQYMFNVPYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEV    141 - 210
LQDPVLKQFKSAFSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSS    211 - 280
VLSHVSGLGWLASYLPSFLRVPKWIIALYTSKF                                         281 - 313
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25052469 2014 Multivariate sequence analysis reveals additional function impacting residues in the SDR superfamily.
24571439 2014 Genome-wide association analyses of child genotype effects and parent-of-origin effects in specific language impairment.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...