Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Retinitis pigmentosa 11 59 4.316 2.2

Expression

AA Sequence

MNRSSNVPRKGILKSGTRSLQKVRRVHFANARNARSLLSMLKDISAQIIQRAWLSHTNKMIFRLLKHAIC      1 - 70
AAEFYVTHEILKKVAPLEAKLIKDPTMQCKIRFRFRGETFPPFIVFKIFLHTDGHGYKYFSGKNVLMPSS     71 - 140
KAVDDACKLMGERKFHRIIMEDERIFPKSKVTDIMDVVTMQDYVQYRSFFDEAPAFSGGRNNSWRKLNLE    141 - 210
NIPRTMLMYDIVHYSESGVISNRLRNEMKFLLQRPVTQEIHKHQLRIVSEIRGPYLTVQPLYRPYKQQNQ    211 - 280
VKFLGRRSKQAQMKVEKMRKVYLAKEKNTSEVTEPKTGPSGTKDNYHLHSIF                      281 - 332
//

Text Mined References (4)

PMID Year Title