Property Summary

NCBI Gene PubMed Count 18
PubMed Score 7.91
PubTator Score 4.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (10)

Disease log2 FC p
acute quadriplegic myopathy 1.133 3.3e-06
Breast cancer -1.200 2.1e-10
group 4 medulloblastoma 1.300 3.9e-03
osteosarcoma -2.294 5.4e-08
ovarian cancer -1.300 2.3e-07
pancreatic cancer -1.500 1.5e-02
pancreatic carcinoma -1.500 1.5e-02
pituitary cancer 1.100 6.8e-03
primary Sjogren syndrome 1.200 1.2e-02
tuberculosis -1.600 1.2e-05

 GWAS Trait (1)

Gene RIF (8)

AA Sequence

MRLIGMPKEKYDPPDPRRIYTIMSAEEVANGKKSHWAELEISGRVRSLSTSLWSLTHLTALHLNDNYLSR      1 - 70
IPPDIAKLHNLVYLDLSSNKLRSLPAELGNMVSLRELLLNNNLLRVLPYELGRLFQLQTLGLKGNPLSQD     71 - 140
ILNLYQDPDGTRKLLNFMLDNLAVHPEQLPPRPWITLKERDQILPSASFTVMCYNVLCDKYATRQLYGYC    141 - 210
PSWALNWEYRKKGIMEEIVNCDADIISLQEVETEQYFTLFLPALKERGYDGFFSPKSRAKIMSEQERKHV    211 - 280
DGCAIFFKTEKFTLVQKHTVEFNQVAMANSDGSEAMLNRVMTKDNIGVAVVLEVHKELFGAGMKPIHAAD    281 - 350
KQLLIVANAHMHWDPEYSDVKLIQTMMFVSEVKNILEKASSRPGSPTADPNSIPLVLCADLNSLPDSGVV    351 - 420
EYLSNGGVADNHKDFKELRYNECLMNFSCNGKNGSSEGRITHGFQLKSAYENNLMPYTNYTFDFKGVIDY    421 - 490
IFYSKTHMNVLGVLGPLDPQWLVENNITGCPHPHIPSDHFSLLTQLELHPPLLPLVNGVHLPNRR         491 - 555
//

Text Mined References (21)

PMID Year Title