Property Summary

NCBI Gene PubMed Count 6
Grant Count 47
R01 Count 27
Funding $8,501,868.33
PubMed Score 168.24
PubTator Score 485.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 1.400 0.012
oligodendroglioma 2.000 0.002
glioblastoma 1.700 0.000
posterior fossa group A ependymoma 1.700 0.000
primary pancreatic ductal adenocarcinoma 1.162 0.007
active ulcerative colitis 1.456 0.013
adult high grade glioma 2.000 0.000
pilocytic astrocytoma 1.400 0.000
ovarian cancer 1.300 0.000
pituitary cancer 1.200 0.004
pancreatic cancer 1.200 0.009

AA Sequence

MDGSGPFSCPICLEPLREPVTLPCGHNFCLACLGALWPHRGASGAGGPGGAARCPLCQEPFPDGLQLRKN      1 - 70
HTLSELLQLRQGSGPGSGPGPAPALAPEPSAPSALPSVPEPSAPCAPEPWPAGEEPVRCDACPEGAALPA     71 - 140
ALSCLSCLASFCPAHLGPHERSPALRGHRLVPPLRRLEESLCPRHLRPLERYCRAERVCLCEACAAQEHR    141 - 210
GHELVPLEQERALQEAEQSKVLSAVEDRMDELGAGIAQSRRTVALIKSAAVAERERVSRLFADAAAALQG    211 - 280
FQTQVLGFIEEGEAAMLGRSQGDLRRQEEQRSRLSRARQNLSQVPEADSVSFLQELLALRLALEDGCGPG    281 - 350
PGPPRELSFTKSSQAVRAVRDMLAVACVNQWEQLRGPGGNEDGPQKLDSEADAEPQDLESTNLLESEAPR    351 - 420
DYFLKFAYIVDLDSDTADKFLQLFGTKGVKRVLCPINYPLSPTRFTHCEQVLGEGALDRGTYYWEVEIIE    421 - 490
GWVSMGVMAEDFSPQEPYDRGRLGRNAHSCCLQWNGRSFSVWFHGLEAPLPHPFSPTVGVCLEYADRALA    491 - 560
FYAVRDGKMSLLRRLKASRPRRGGIPASPIDPFQSRLDSHFAGLFTHRLKPAFFLESVDAHLQIGPLKKS    561 - 630
CISVLKRR                                                                  631 - 638
//

Text Mined References (12)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21681796 2011 Genome-wide association studies of cerebral white matter lesion burden: the CHARGE consortium.
21269460 2011 Initial characterization of the human central proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...