Property Summary

NCBI Gene PubMed Count 9
PubMed Score 172.85
PubTator Score 485.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
active ulcerative colitis 1.456 1.3e-02
adult high grade glioma 2.000 1.3e-06
astrocytic glioma 1.400 1.2e-02
Astrocytoma, Pilocytic 1.400 5.6e-06
ependymoma 1.200 1.3e-04
glioblastoma 1.200 2.7e-04
oligodendroglioma 2.000 1.9e-03
ovarian cancer 1.300 1.8e-04
pancreatic cancer 1.200 8.7e-03
pituitary cancer 1.200 4.5e-03
primary pancreatic ductal adenocarcinoma 1.162 6.9e-03

Gene RIF (3)

AA Sequence

MDGSGPFSCPICLEPLREPVTLPCGHNFCLACLGALWPHRGASGAGGPGGAARCPLCQEPFPDGLQLRKN      1 - 70
HTLSELLQLRQGSGPGSGPGPAPALAPEPSAPSALPSVPEPSAPCAPEPWPAGEEPVRCDACPEGAALPA     71 - 140
ALSCLSCLASFCPAHLGPHERSPALRGHRLVPPLRRLEESLCPRHLRPLERYCRAERVCLCEACAAQEHR    141 - 210
GHELVPLEQERALQEAEQSKVLSAVEDRMDELGAGIAQSRRTVALIKSAAVAERERVSRLFADAAAALQG    211 - 280
FQTQVLGFIEEGEAAMLGRSQGDLRRQEEQRSRLSRARQNLSQVPEADSVSFLQELLALRLALEDGCGPG    281 - 350
PGPPRELSFTKSSQAVRAVRDMLAVACVNQWEQLRGPGGNEDGPQKLDSEADAEPQDLESTNLLESEAPR    351 - 420
DYFLKFAYIVDLDSDTADKFLQLFGTKGVKRVLCPINYPLSPTRFTHCEQVLGEGALDRGTYYWEVEIIE    421 - 490
GWVSMGVMAEDFSPQEPYDRGRLGRNAHSCCLQWNGRSFSVWFHGLEAPLPHPFSPTVGVCLEYADRALA    491 - 560
FYAVRDGKMSLLRRLKASRPRRGGIPASPIDPFQSRLDSHFAGLFTHRLKPAFFLESVDAHLQIGPLKKS    561 - 630
CISVLKRR                                                                  631 - 638
//

Text Mined References (15)

PMID Year Title