Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.72
PubTator Score 6.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Amphetamine-Related Disorders 74 0.0 0.0
Skin Diseases 71 0.0 0.0
Disease Target Count P-value
lung carcinoma 2843 1.3e-18
psoriasis 6694 9.9e-09
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Disease of anatomical entity 32 0.0 1.7
Refractive error 50 0.0 0.8

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 3.600 1.3e-18
psoriasis -1.200 9.9e-09

Gene RIF (4)

AA Sequence

MTREQYILATQQNNLPRTENAQLYPVGIYGWRKRCLYFFVLLLLVTMIVNLAMTIWILKVMNFTVDGMGN      1 - 70
LRVTKKGIRLEGISEFLLPLYVKEIHSRKDSPLVLQSDRNVTVNARNHMGQLTGQLTIGADAVEAQCKRF     71 - 140
EVRASEDGRVLFSADEDEITIGAEKLKVTGTEGAVFGHSVETPHIRAEPSQDLRLESPTRSLIMEAPRGV    141 - 210
QVSAAAGDFKATCRKELHLQSTEGEIFLNAETIKLGNLPTGSFSSSSPSSSSSRQTVYELCVCPNGKLYL    211 - 280
SPAGVGSTCQSSSNICLWS                                                       281 - 299
//

Text Mined References (13)

PMID Year Title