Property Summary

NCBI Gene PubMed Count 13
Grant Count 2
Funding $123,513.33
PubMed Score 6.48
PubTator Score 6.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 3.600 0.000
psoriasis -1.200 0.000

Synonym

Accession Q96LD1 Q6REU0 Zeta-SG
Symbols ZSG1

Gene

PANTHER Protein Class (1)

 Grant Application (2)

Gene RIF (4)

PMID Text
24792710 No pathogenic SGCZ mutations were identified
22836685 three CNVs associated with BMI, obesity, and other obesity-related traits after adjusting for multiple testing. These CNVs overlap the PARK2, GYPA, and SGCZ genes
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19472918 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTREQYILATQQNNLPRTENAQLYPVGIYGWRKRCLYFFVLLLLVTMIVNLAMTIWILKVMNFTVDGMGN      1 - 70
LRVTKKGIRLEGISEFLLPLYVKEIHSRKDSPLVLQSDRNVTVNARNHMGQLTGQLTIGADAVEAQCKRF     71 - 140
EVRASEDGRVLFSADEDEITIGAEKLKVTGTEGAVFGHSVETPHIRAEPSQDLRLESPTRSLIMEAPRGV    141 - 210
QVSAAAGDFKATCRKELHLQSTEGEIFLNAETIKLGNLPTGSFSSSSPSSSSSRQTVYELCVCPNGKLYL    211 - 280
SPAGVGSTCQSSSNICLWS                                                       281 - 299
//

Text Mined References (13)

PMID Year Title
24792710 2014 SGCZ mutations are unlikely to be associated with myoclonus dystonia.
23594818 2013 Evidence for shared genetic risk between methamphetamine-induced psychosis and schizophrenia.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22836685 2012 Copy number variations associated with obesity-related traits in African Americans: a joint analysis between GENOA and HyperGEN.
20526338 2010 Genome-wide meta-analyses identifies seven loci associated with platelet aggregation in response to agonists.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19472918 2008 Candidate-gene testing for orphan limb-girdle muscular dystrophies.
18625863 2008 A novel locus for generalized epilepsy with febrile seizures plus in French families.
17438352 2007 Sarcoglycan subcomplex expression in normal human smooth muscle.
More...