Property Summary

NCBI Gene PubMed Count 33
Grant Count 15
R01 Count 8
Funding $763,013.74
PubMed Score 48.85
PubTator Score 22.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 0.000
glioblastoma 1.100 0.000
group 3 medulloblastoma 1.600 0.000
medulloblastoma, large-cell 1.400 0.001

Gene RIF (18)

PMID Text
26181206 these findings suggest that p53-R273H can specifically drive AKT signaling and suppress BMF expression, resulting in enhanced cell survivability and anoikis resistance.
25321483 On the corresponding BMF gene promoter, loss of HDAC8 was associated with signal transducer and activator of transcription 3 (STAT3)/specificity protein 3 (Sp3) transcription factor exchange and recruitment of p300.
24901046 Overexpression of ApoL2 did not induce cell death on its own. ApoL2 did not sensitize or protect cells from overexpression of the BH3-only proteins Bmf or Noxa.
23192964 Diva binds peptides derived from the BH3 domain of several other proapoptotic Bcl-2 proteins, including mouse Harakiri, Bid, Bak and Bmf.
21673109 BMF is induced in human IEC by the loss of cell attachment and is likely to play an important role in the regulation of IEC survival
20861305 Data show that hypoxic conditions inhibit anoikis and block expression of proapoptotic BH3-only family members Bim and Bmf in epithelial cells.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20706276 characterization of the bmf gene locus; molecular basis of the generation of the 2 major isoforms of Bmf; provide evidence that Bmf can act as a sensor for stress that associates with the repression of the conventional CAP-dependent translation machinery
19671867 MicroRNA-221 targets Bmf in hepatocellular carcinoma and correlates with tumor multifocality.
19641506 Bmf supports Bim in regulating cell death processes in response to many stimuli. Review.
More...

AA Sequence

MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKAT      1 - 70
QTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCI     71 - 140
ADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR                              141 - 184
//

Text Mined References (33)

PMID Year Title
26181206 2015 Mutant p53-R273H mediates cancer cell survival and anoikis resistance through AKT-dependent suppression of BCL2-modifying factor (BMF).
25416956 2014 A proteome-scale map of the human interactome network.
25321483 2014 HDAC8 and STAT3 repress BMF gene activity in colon cancer cells.
24901046 2014 Apolipoprotein L2 contains a BH3-like domain but it does not behave as a BH3-only protein.
24292274 2014 A genome-wide association study identifies multiple susceptibility loci for chronic lymphocytic leukemia.
23192964 2012 Nuclear magnetic resonance study of protein-protein interactions involving apoptosis regulator Diva (Boo) and the BH3 domain of proapoptotic Bcl-2 members.
22327514 2012 Common variants near TARDBP and EGR2 are associated with susceptibility to Ewing sarcoma.
21673109 2011 BCL-2 modifying factor (BMF) is a central regulator of anoikis in human intestinal epithelial cells.
21533175 2011 Eight common genetic variants associated with serum DHEAS levels suggest a key role in ageing mechanisms.
20861305 2010 Hypoxia suppression of Bim and Bmf blocks anoikis and luminal clearing during mammary morphogenesis.
More...