Property Summary

NCBI Gene PubMed Count 20
Grant Count 16
R01 Count 13
Funding $619,255.03
PubMed Score 37.85
PubTator Score 9.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.100 0.000
psoriasis 1.100 0.000

Gene RIF (7)

PMID Text
26039076 a significant induction of three PGLYRPs 2-4 in primary human corneal epithelial cells (HCECs) exposed to live or heat-killed Candida albicans, is reported.
22099350 anti-inflammatory role in intestinal epithelial cells during antibacterial immune response
21451128 expression of PGlyRP3 can be regulated by dietary factors such as probiotic oligosaccharides; PPARgamma is involved in regulation of expression of PGlyRP3 in intestinal mucosa by dietary components
20237496 Observational study of gene-disease association. (HuGE Navigator)
19601998 Observational study of gene-disease association. (HuGE Navigator)
16362825 Data are consistent with previous reports of association of psoriasis with genes on 1q21, and suggest a role for Pglyrp3 in skin biology.
16354652 Results describe the function of mammalian antimicrobial peptidoglycan recognition proteins 3 and 4, and show that they are a new class of bactericidal and bacteriostatic proteins.

AA Sequence

MGTLPWLLAFFILGLQAWDTPTIVSRKEWGARPLACRALLTLPVAYIITDQLPGMQCQQQSVCSQMLRGL      1 - 70
QSHSVYTIGWCDVAYNFLVGDDGRVYEGVGWNIQGLHTQGYNNISLGIAFFGNKIGSSPSPAALSAAEGL     71 - 140
ISYAIQKGHLSPRYIQPLLLKEETCLDPQHPVMPRKVCPNIIKRSAWEARETHCPKMNLPAKYVIIIHTA    141 - 210
GTSCTVSTDCQTVVRNIQSFHMDTRNFCDIGYHFLVGQDGGVYEGVGWHIQGSHTYGFNDIALGIAFIGY    211 - 280
FVEKPPNAAALEAAQDLIQCAVVEGYLTPNYLLMGHSDVVNILSPGQALYNIISTWPHFKH             281 - 341
//

Text Mined References (21)

PMID Year Title
26039076 2015 A Novel Innate Response of Human Corneal Epithelium to Heat-killed Candida albicans by Producing Peptidoglycan Recognition Proteins.
22099350 2012 Peptidoglycan recognition protein 3 (PglyRP3) has an anti-inflammatory role in intestinal epithelial cells.
21602801 2011 Peptidoglycan recognition proteins kill bacteria by activating protein-sensing two-component systems.
21451128 2011 Prebiotic oligosaccharides reduce proinflammatory cytokines in intestinal Caco-2 cells via activation of PPAR? and peptidoglycan recognition protein 3.
21176858 2011 PPAR?-dependent peptidoglycan recognition protein 3 (PGlyRP3) expression regulates proinflammatory cytokines by microbial and dietary fatty acids.
20418257 2010 Review: Mammalian peptidoglycan recognition proteins (PGRPs) in innate immunity.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19601998 2009 Variation in genes of the epidermal differentiation complex in German atopic dermatitis patients.
17502600 2007 Structural insights into the bactericidal mechanism of human peptidoglycan recognition proteins.
17363965 2007 Peptidoglycan recognition proteins: pleiotropic sensors and effectors of antimicrobial defences.
More...