Property Summary

NCBI Gene PubMed Count 10
Grant Count 10
R01 Count 8
Funding $445,515.57
PubMed Score 3.77
PubTator Score 5.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.036 0.001
medulloblastoma, large-cell 1.500 0.000
diabetes mellitus 1.100 0.002
adult high grade glioma 1.100 0.004
psoriasis 1.600 0.000
ovarian cancer 1.600 0.000

Gene RIF (7)

PMID Text
26039076 a significant induction of three PGLYRPs 2-4 in primary human corneal epithelial cells (HCECs) exposed to live or heat-killed Candida albicans, is reported.
24838182 This study demonistrated that PGLYRP4 single-nucleotide polymorphisms is risk of Parkinson's disease.
23867815 HIV-1 gp120-treated vaginal epithelial cells show upregulation of peptidoglycan recognition protein 4 (PGLYRP4) expression as compared to untreated control
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
16362825 Data are consistent with previous reports of association of psoriasis with genes on 1q21, and suggest a role for Pglyrp4 in skin biology.
16354652 Results describe the function of mammalian antimicrobial peptidoglycan recognition proteins 3 and 4, and show that they are a new class of bactericidal and bacteriostatic proteins.

AA Sequence

MLPWLLVFSALGIQAWGDSSWNKTQAKQVSEGLQYLFENISQLTEKGLPTDVSTTVSRKAWGAEAVGCSI      1 - 70
QLTTPVNVLVIHHVPGLECHDQTVCSQRLRELQAHHVHNNSGCDVAYNFLVGDDGRVYEGVGWNIQGVHT     71 - 140
QGYNNISLGFAFFGTKKGHSPSPAALSAMENLITYAVQKGHLSSSYVQPLLGKGENCLAPRQKTSLKKAC    141 - 210
PGVVPRSVWGARETHCPRMTLPAKYGIIIHTAGRTCNISDECRLLVRDIQSFYIDRLKSCDIGYNFLVGQ    211 - 280
DGAIYEGVGWNVQGSSTPGYDDIALGITFMGTFTGIPPNAAALEAAQDLIQCAMVKGYLTPNYLLVGHSD    281 - 350
VARTLSPGQALYNIISTWPHFKH                                                   351 - 373
//

Text Mined References (12)

PMID Year Title
26039076 2015 A Novel Innate Response of Human Corneal Epithelium to Heat-killed Candida albicans by Producing Peptidoglycan Recognition Proteins.
24838182 2014 Peptidoglycan recognition protein genes and risk of Parkinson's disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
17502600 2007 Structural insights into the bactericidal mechanism of human peptidoglycan recognition proteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16362825 2006 Peptidoglycan recognition proteins Pglyrp3 and Pglyrp4 are encoded from the epidermal differentiation complex and are candidate genes for the Psors4 locus on chromosome 1q21.
16354652 2006 Peptidoglycan recognition proteins are a new class of human bactericidal proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...