Property Summary

NCBI Gene PubMed Count 21
PubMed Score 4.31
PubTator Score 1.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Renal oncocytoma 22 3.899 1.9

Synonym

Accession Q96LB4 Q495K2 Q495K4 Q5T9L6 V-ATPase subunit G 3
Symbols Vma10
ATP6G3

Gene

Gene RIF (3)

PMID Text
25013050 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that ATP6V1G3 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with ATP6V1G3
24968937 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that ATP6V1G3 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with ATP6V1G3
19366680 V-ATPases affecting the pH of the cytosol and intracellular compartments, particularly those containing a3, are also involved in invasion in breast cancer

AA Sequence

MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLS      1 - 70
DEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN                           71 - 118
//

Text Mined References (21)

PMID Year Title
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
19366680 2009 Function of a subunit isoforms of the V-ATPase in pH homeostasis and in vitro invasion of MDA-MB231 human breast cancer cells.
17662945 2007 Coupling of rotation and catalysis in F(1)-ATPase revealed by single-molecule imaging and manipulation.
17360703 2007 V1 and V0 domains of the human H+-ATPase are linked by an interaction between the G and a subunits.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14597263 2003 Neurotransmitter release: the dark side of the vacuolar-H+ATPase.
14580332 2003 Revised nomenclature for mammalian vacuolar-type H+ -ATPase subunit genes.
12788495 2003 Proton translocation driven by ATP hydrolysis in V-ATPases.
More...