Property Summary

NCBI Gene PubMed Count 21
PubMed Score 4.31
PubTator Score 1.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Renal oncocytoma 22 3.906 2.0

Protein-protein Interaction (1)

Gene RIF (3)

AA Sequence

MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLS      1 - 70
DEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN                           71 - 118
//

Text Mined References (21)

PMID Year Title