Property Summary

NCBI Gene PubMed Count 19
PubMed Score 6.07
PubTator Score 7.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
BARDET-BIEDL SYNDROME 20 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Bardet-Biedl syndrome 51 0.0 4.0
Obesity 678 0.0 4.0
Disease Target Count Z-score Confidence
Ciliopathy 71 3.835 1.9
Frontotemporal dementia 51 3.169 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 2.2e-03
chronic rhinosinusitis -1.134 2.5e-02
cystic fibrosis and chronic rhinosinusit... -1.014 3.1e-02
ependymoma 1.800 5.4e-10
osteosarcoma -2.477 3.3e-04
psoriasis -1.500 1.6e-04

 IMPC Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (8)

Gene RIF (2)

AA Sequence

MASNHKSSAARPVSRGGVGLTGRPPSGIRPLSGNIRVATAMPPGTARPGSRGCPIGTGGVLSSQIKVAHR      1 - 70
PVTQQGLTGMKTGTKGPQRQILDKSYYLGLLRSKISELTTEVNKLQKGIEMYNQENSVYLSYEKRAETLA     71 - 140
VEIKELQGQLADYNMLVDKLNTNTEMEEVMNDYNMLKAQNDRETQSLDVIFTERQAKEKQIRSVEEEIEQ    141 - 210
EKQATDDIIKNMSFENQVKYLEMKTTNEKLLQELDTLQQQLDSQNMKKESLEAEIAHSQVKQEAVLLHEK    211 - 280
LYELESHRDQMIAEDKSIGSPMEEREKLLKQIKDDNQEIASMERQLTDTKEKINQFIEEIRQLDMDLEEH    281 - 350
QGEMNQKYKELKKREEHMDTFIETFEETKNQELKRKAQIEANIVALLEHCSRNINRIEQISSITNQELKM    351 - 420
MQDDLNFKSTEVQKSQSTAQNLTSDIQRLQLDLQKMELLESKMTEEQHSLKSKIKQMTTDLEIYNDLPAL    421 - 490
KSSGEEKIKKLHQERMILSTHRNAFKKIMEKQNIEYEALKTQLQENETHSQLTNLERKWQHLEQNNFAMK    491 - 560
EFIATKSQESDYQPIKKNVTKQIAEYNKTIVDALHSTSGN                                  561 - 600
//

Text Mined References (23)

PMID Year Title