Property Summary

NCBI Gene PubMed Count 9
Grant Count 6
Funding $969,853.33
PubMed Score 5.86
PubTator Score 7.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Gene RIF (2)

PMID Text
23990561 this study found that the two core intraflagellar transport proteins IFT74 and IFT81 form a tubulin-binding module and mapped the interaction to a calponin homology domain of IFT81 and a highly basic domain in IFT74.
17383054 The results revealed that the common variations in IFT74 and GRN neither constitute strong ALS risk factors nor modify the age-at-onset.

AA Sequence

MASNHKSSAARPVSRGGVGLTGRPPSGIRPLSGNIRVATAMPPGTARPGSRGCPIGTGGVLSSQIKVAHR      1 - 70
PVTQQGLTGMKTGTKGPQRQILDKSYYLGLLRSKISELTTEVNKLQKGIEMYNQENSVYLSYEKRAETLA     71 - 140
VEIKELQGQLADYNMLVDKLNTNTEMEEVMNDYNMLKAQNDRETQSLDVIFTERQAKEKQIRSVEEEIEQ    141 - 210
EKQATDDIIKNMSFENQVKYLEMKTTNEKLLQELDTLQQQLDSQNMKKESLEAEIAHSQVKQEAVLLHEK    211 - 280
LYELESHRDQMIAEDKSIGSPMEEREKLLKQIKDDNQEIASMERQLTDTKEKINQFIEEIRQLDMDLEEH    281 - 350
QGEMNQKYKELKKREEHMDTFIETFEETKNQELKRKAQIEANIVALLEHCSRNINRIEQISSITNQELKM    351 - 420
MQDDLNFKSTEVQKSQSTAQNLTSDIQRLQLDLQKMELLESKMTEEQHSLKSKIKQMTTDLEIYNDLPAL    421 - 490
KSSGEEKIKKLHQERMILSTHRNAFKKIMEKQNIEYEALKTQLQENETHSQLTNLERKWQHLEQNNFAMK    491 - 560
EFIATKSQESDYQPIKKNVTKQIAEYNKTIVDALHSTSGN                                  561 - 600
//

Text Mined References (14)

PMID Year Title
24339792 2013 Active transport and diffusion barriers restrict Joubert Syndrome-associated ARL13B/ARL-13 to an Inv-like ciliary membrane subdomain.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23990561 2013 Molecular basis of tubulin transport within the cilium by IFT74 and IFT81.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17383054 2008 Genetic studies of GRN and IFT74 in amyotrophic lateral sclerosis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15955805 2005 Characterization of the intraflagellar transport complex B core: direct interaction of the IFT81 and IFT74/72 subunits.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
15024030 2004 Primary cilia of human endothelial cells disassemble under laminar shear stress.
More...