Property Summary

NCBI Gene PubMed Count 7
Grant Count 7
R01 Count 5
Funding $396,521.25
PubMed Score 16.55
PubTator Score 14.84

Knowledge Summary

Patent (4,349)

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
diabetes mellitus 1,663
psoriasis 6,685

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
743016 confirmatory 15 / 0 / 0 Identification of compounds that allosterically activate MrgX1 receptor signaling
743250 screening 1 / 0 / 0 Discovery and characterization of a small molecule allosteric agonists of mas-related G-Protein coupled receptor X1 ( MrgX1)

Gene RIF (1)

PMID Text
23074220 analysis of the functional interactions between MRGPR-X1 and TRPV1

AA Sequence

MDPTISTLDTELTPINGTEETLCYKQTLSLTVLTCIVSLVGLTGNAVVLWLLGCRMRRNAFSIYILNLAA      1 - 70
ADFLFLSGRLIYSLLSFISIPHTISKILYPVMMFSYFAGLSFLSAVSTERCLSVLWPIWYRCHRPTHLSA     71 - 140
VVCVLLWALSLLRSILEWMLCGFLFSGADSAWCQTSDFITVAWLIFLCVVLCGSSLVLLIRILCGSRKIP    141 - 210
LTRLYVTILLTVLVFLLCGLPFGIQFFLFLWIHVDREVLFCHVHLVSIFLSALNSSANPIIYFFVGSFRQ    211 - 280
RQNRQNLKLVLQRALQDASEVDEGGGQLPEEILELSGSRLEQ                                281 - 322
//

Text Mined References (10)

PMID Year Title
26582731 2016 Novel Probes Establish Mas-Related G Protein-Coupled Receptor X1 Variants as Receptors with Loss or Gain of Function.
24583173 2014 Comparative genomic analysis of eutherian Mas-related G protein-coupled receptor genes.
23074220 2012 Human sensory neuron-specific Mas-related G protein-coupled receptors-X1 sensitize and directly activate transient receptor potential cation channel V1 via distinct signaling pathways.
20004959 2009 Sensory neuron-specific GPCR Mrgprs are itch receptors mediating chloroquine-induced pruritus.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12044878 2002 Identification of G protein-coupled receptor genes from the human genome sequence.
11850634 2002 Proenkephalin A gene products activate a new family of sensory neuron--specific GPCRs.
11551509 2001 A diverse family of GPCRs expressed in specific subsets of nociceptive sensory neurons.