Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.74
PubTator Score 2.85

Knowledge Summary

Patent (2,424)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Bullous keratopathy 7 4.311 2.2

Gene RIF (1)

PMID Text
15809047 overexpression of the human MrgX3 gene causes a disturbance of the normal cell-differentiation process

AA Sequence

MDSTIPVLGTELTPINGREETPCYKQTLSFTGLTCIVSLVALTGNAVVLWLLGCRMRRNAVSIYILNLVA      1 - 70
ADFLFLSGHIICSPLRLINIRHPISKILSPVMTFPYFIGLSMLSAISTERCLSILWPIWYHCRRPRYLSS     71 - 140
VMCVLLWALSLLRSILEWMFCDFLFSGANSVWCETSDFITIAWLVFLCVVLCGSSLVLLVRILCGSRKMP    141 - 210
LTRLYVTILLTVLVFLLCGLPFGIQWALFSRIHLDWKVLFCHVHLVSIFLSALNSSANPIIYFFVGSFRQ    211 - 280
RQNRQNLKLVLQRALQDTPEVDEGGGWLPQETLELSGSRLEQ                                281 - 322
//

Text Mined References (7)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16284629 2006 Characterization of the Mas-related gene family: structural and functional conservation of human and rhesus MrgX receptors.
15809047 2005 Transgenic rats overexpressing the human MrgX3 gene show cataracts and an abnormal skin phenotype.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11850634 2002 Proenkephalin A gene products activate a new family of sensory neuron--specific GPCRs.
11551509 2001 A diverse family of GPCRs expressed in specific subsets of nociceptive sensory neurons.