Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.85
PubTator Score 2.85

Knowledge Summary

Patent (2,424)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Bullous keratopathy 7 4.336 2.2

Expression

Gene RIF (2)

AA Sequence

MDSTIPVLGTELTPINGREETPCYKQTLSFTGLTCIVSLVALTGNAVVLWLLGCRMRRNAVSIYILNLVA      1 - 70
ADFLFLSGHIICSPLRLINIRHPISKILSPVMTFPYFIGLSMLSAISTERCLSILWPIWYHCRRPRYLSS     71 - 140
VMCVLLWALSLLRSILEWMFCDFLFSGANSVWCETSDFITIAWLVFLCVVLCGSSLVLLVRILCGSRKMP    141 - 210
LTRLYVTILLTVLVFLLCGLPFGIQWALFSRIHLDWKVLFCHVHLVSIFLSALNSSANPIIYFFVGSFRQ    211 - 280
RQNRQNLKLVLQRALQDTPEVDEGGGWLPQETLELSGSRLEQ                                281 - 322
//

Text Mined References (8)

PMID Year Title