Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.43
PubTator Score 0.46

Knowledge Summary

Patent (1,244)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 7.7205362486478E-5
diabetes mellitus 1663 0.0010989976094107
Disease Target Count Z-score Confidence
ulcerative colitis 2087 0.0 2.0

Synonym

Accession Q96LA9 Q3KNU3 Q3KNU4 Q502W0 Q8TDD6 Q8TDD7
Symbols GPCR
MRGX4
SNSR6

Gene

PANTHER Protein Class (2)

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid

  TechDev Info (1)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MDPTVPVFGTKLTPINGREETPCYNQTLSFTVLTCIISLVGLTGNAVVLWLLGYRMRRNAVSIYILNLAA      1 - 70
ADFLFLSFQIIRLPLRLINISHLIRKILVSVMTFPYFTGLSMLSAISTERCLSVLWPIWYRCRRPTHLSA     71 - 140
VVCVLLWGLSLLFSMLEWRFCDFLFSGADSSWCETSDFIPVAWLIFLCVVLCVSSLVLLVRILCGSRKMP    141 - 210
LTRLYVTILLTVLVFLLCGLPFGILGALIYRMHLNLEVLYCHVYLVCMSLSSLNSSANPIIYFFVGSFRQ    211 - 280
RQNRQNLKLVLQRALQDKPEVDKGEGQLPEESLELSGSRLGP                                281 - 322
//

Text Mined References (6)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11850634 2002 Proenkephalin A gene products activate a new family of sensory neuron--specific GPCRs.
11551509 2001 A diverse family of GPCRs expressed in specific subsets of nociceptive sensory neurons.