Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.43
PubTator Score 0.46

Knowledge Summary

Patent (1,244)

TINX Plot

  Disease Relevance (3)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MDPTVPVFGTKLTPINGREETPCYNQTLSFTVLTCIISLVGLTGNAVVLWLLGYRMRRNAVSIYILNLAA      1 - 70
ADFLFLSFQIIRLPLRLINISHLIRKILVSVMTFPYFTGLSMLSAISTERCLSVLWPIWYRCRRPTHLSA     71 - 140
VVCVLLWGLSLLFSMLEWRFCDFLFSGADSSWCETSDFIPVAWLIFLCVVLCVSSLVLLVRILCGSRKMP    141 - 210
LTRLYVTILLTVLVFLLCGLPFGILGALIYRMHLNLEVLYCHVYLVCMSLSSLNSSANPIIYFFVGSFRQ    211 - 280
RQNRQNLKLVLQRALQDKPEVDKGEGQLPEESLELSGSRLGP                                281 - 322
//

Text Mined References (6)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11850634 2002 Proenkephalin A gene products activate a new family of sensory neuron--specific GPCRs.
11551509 2001 A diverse family of GPCRs expressed in specific subsets of nociceptive sensory neurons.