Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.43
PubTator Score 0.46

Knowledge Summary

Patent (1,244)

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 7.7e-05
diabetes mellitus 1728 1.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
lung cancer 4740 0.0 0.5
Disease Target Count Z-score Confidence
ulcerative colitis 1819 0.0 2.5

Gene RIF (1)

AA Sequence

MDPTVPVFGTKLTPINGREETPCYNQTLSFTVLTCIISLVGLTGNAVVLWLLGYRMRRNAVSIYILNLAA      1 - 70
ADFLFLSFQIIRLPLRLINISHLIRKILVSVMTFPYFTGLSMLSAISTERCLSVLWPIWYRCRRPTHLSA     71 - 140
VVCVLLWGLSLLFSMLEWRFCDFLFSGADSSWCETSDFIPVAWLIFLCVVLCVSSLVLLVRILCGSRKMP    141 - 210
LTRLYVTILLTVLVFLLCGLPFGILGALIYRMHLNLEVLYCHVYLVCMSLSSLNSSANPIIYFFVGSFRQ    211 - 280
RQNRQNLKLVLQRALQDKPEVDKGEGQLPEESLELSGSRLGP                                281 - 322
//

Text Mined References (6)

PMID Year Title