Property Summary

Ligand Count 21
NCBI Gene PubMed Count 50
PubMed Score 48.33
PubTator Score 46.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 1.2e-03
atypical teratoid / rhabdoid tumor 1.400 1.1e-04
hepatocellular carcinoma 1.200 1.9e-04
medulloblastoma 1.100 7.4e-03
medulloblastoma, large-cell 1.600 3.6e-03
osteosarcoma 1.143 9.2e-03
primitive neuroectodermal tumor 1.100 4.5e-03

 MGI Phenotype (1)

Protein-protein Interaction (10)

Gene RIF (45)

AA Sequence

MSQPKKRKLESGGGGEGGEGTEEEDGAEREAALERPRRTKRERDQLYYECYSDVSVHEEMIADRVRTDAY      1 - 70
RLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYAVEASAIWQQAREVVRFNGLEDRVHVLPGPV     71 - 140
ETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFIAPISDQMLEWRLGFWSQ    141 - 210
VKQHYGVDMSCLEGFATRCLMGHSEIVVQGLSGEDVLARPQRFAQLELSRAGLEQELEAGVGGRFRCSCY    211 - 280
GSAPMHGFAIWFQVTFPGGESEKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNP    281 - 350
RRLRVLLRYKVGDQEEKTKDFAMED                                                 351 - 375
//

Text Mined References (60)

PMID Year Title