Property Summary

NCBI Gene PubMed Count 48
Grant Count 12
R01 Count 3
Funding $894,357.04
PubMed Score 44.54
PubTator Score 46.71

Knowledge Summary

Patent

No data available

Expression

Gene RIF (53)

PMID Text
26848759 PRMT6 influences PRC-mediated gene silencing at the rostral HOXA genes locus.
26690413 PRMT6, which was down-regulated by androgen receptors and influenced cell migration and apoptosis of germ cells, could play a potentially important role in spermatogenesis.
26611710 Data show that HIV-1 Tat methylation by protein arginine methyltransferase 6 (PRMT6) can inhibit nucleolar retention.
26436589 PRMT6 methylates tumor cell p21 at arginine 156 and promotes phosphorylation of threonine 145 on p21, increasing the cytoplasmic localization of p21 and inducing resistance to anticancer drugs.
26178996 N terminus is methylated by PRMT6 and that this critically affects the functions of pUL69 for efficient mRNA export and replication of human cytomegalovirus.
26070566 TBL1 is required to protect GPS2 from degradation, with methylation of GPS2 by arginine methyltransferase PRMT6 regulating the interaction with TBL1 and inhibiting proteasome-dependent degradation.
25481537 PRMT6 mediates cigarette smoke extract induced apoptosis and inflammation through H3R2me2a in HUVECs.
24742914 PRMT6 specifically interacts with ERalpha at its ligand-binding domain.
23980157 Arginine 42 of histone H3 (H3R42), is dimethylated by the methyltransferases coactivator arginine methyltransferase 1 (CARM1) and protein arginine methyltransferase 6 (PRMT6) in vitro and in vivo.
23911394 Data show arginine methyltransferase PRMT6 methylates the AT-hook motif of regulatory factor RFX5 and downregulates HLA-DQ expression.
More...

AA Sequence

MSQPKKRKLESGGGGEGGEGTEEEDGAEREAALERPRRTKRERDQLYYECYSDVSVHEEMIADRVRTDAY      1 - 70
RLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYAVEASAIWQQAREVVRFNGLEDRVHVLPGPV     71 - 140
ETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFIAPISDQMLEWRLGFWSQ    141 - 210
VKQHYGVDMSCLEGFATRCLMGHSEIVVQGLSGEDVLARPQRFAQLELSRAGLEQELEAGVGGRFRCSCY    211 - 280
GSAPMHGFAIWFQVTFPGGESEKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNP    281 - 350
RRLRVLLRYKVGDQEEKTKDFAMED                                                 351 - 375
//

Text Mined References (58)

PMID Year Title
26848759 2016 The Arginine Methyltransferase PRMT6 Cooperates with Polycomb Proteins in Regulating HOXA Gene Expression.
26690413 2015 Protein Arginine Methyltransferase 6 Involved in Germ Cell Viability during Spermatogenesis and Down-Regulated by the Androgen Receptor.
26611710 2016 The protein arginine methyltransferase PRMT6 inhibits HIV-1 Tat nucleolar retention.
26436589 2015 PRMT6 increases cytoplasmic localization of p21CDKN1A in cancer cells through arginine methylation and makes more resistant to cytotoxic agents.
26178996 2015 pUL69 of Human Cytomegalovirus Recruits the Cellular Protein Arginine Methyltransferase 6 via a Domain That Is Crucial for mRNA Export and Efficient Viral Replication.
26070566 2015 Exchange Factor TBL1 and Arginine Methyltransferase PRMT6 Cooperate in Protecting G Protein Pathway Suppressor 2 (GPS2) from Proteasomal Degradation.
25481537 2015 PRMT6 mediates CSE induced inflammation and apoptosis.
25416956 2014 A proteome-scale map of the human interactome network.
24742914 2014 Protein arginine methyltransferase 6 enhances ligand-dependent and -independent activity of estrogen receptor ? via distinct mechanisms.
24165912 2013 Genome-wide association study identifies 8 novel loci associated with blood pressure responses to interventions in Han Chinese.
More...