Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.05
PubTator Score 12.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 5.5e-06
primary Sjogren syndrome 735 3.4e-05
psoriasis 6694 5.8e-05
tuberculosis 2010 2.9e-04
nasopharyngeal carcinoma 1058 6.2e-03
interstitial cystitis 2312 1.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (6)

Disease log2 FC p
interstitial cystitis 1.700 1.6e-02
nasopharyngeal carcinoma -1.100 6.2e-03
osteosarcoma -2.585 5.5e-06
primary Sjogren syndrome 1.800 3.4e-05
psoriasis 1.300 5.8e-05
tuberculosis 2.100 2.9e-04

Gene RIF (8)

AA Sequence

MLPRLLLLICAPLCEPAELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRDTRALGPGWSSSPK      1 - 70
LQIAAMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLETQPPGGQVMEGDRLVLICSVAMGT     71 - 140
GDITFLWYKGAVGLNLQSKTQRSLTAEYEIPSVRESDAEQYYCVAENGYGPSPSGLVSITVRIPVSRPIL    141 - 210
MLRAPRAQAAVEDVLELHCEALRGSPPILYWFYHEDITLGSRSAPSGGGASFNLSLTEEHSGNYSCEANN    211 - 280
GLGAQRSEAVTLNFTVPTGARSNHLTSGVIEGLLSTLGPATVALLFCYGLKRKIGRRSARDPLRSLPSPL    281 - 350
PQEFTYLNSPTPGQLQPIYENVNVVSGDEVYSLAYYNQPEQESVAAETLGTHMEDKVSLDIYSRLRKANI    351 - 420
TDVDYEDAM                                                                 421 - 429
//

Text Mined References (21)

PMID Year Title