Property Summary

NCBI Gene PubMed Count 19
PubMed Score 7.77
PubTator Score 8.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 4.12658036206462E-9
primary Sjogren syndrome 789 9.99979885911526E-5
ulcerative colitis 2087 0.00141178813147219
nasopharyngeal carcinoma 1056 0.00144606226308124
tuberculosis and treatment for 3 months 327 0.00166065955064832
interstitial cystitis 2299 0.0118080188685607

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -3.396 0.000
tuberculosis and treatment for 3 months 2.000 0.002
interstitial cystitis 2.800 0.012
primary Sjogren syndrome 2.300 0.000
nasopharyngeal carcinoma -1.600 0.001
ulcerative colitis 1.400 0.001

Synonym

Accession Q96LA5 A0N0M5 A1L307 A6NMS0 Q6NTA1 Q9BZI4 Q9BZI5 Q9BZI6 FcR-like protein 2
Symbols FCRH2
IFGP4
IRTA4
SPAP1
CD307b
SPAP1A
SPAP1B
SPAP1C

Gene

PANTHER Protein Class (1)

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Opossum OMA EggNOG

Gene RIF (7)

PMID Text
25738996 FCRL2 overexpression in B cells from Hashimoto and Graves disease patients compared to normal subjects.
21068405 a negative immunomodulatory function for FCRL2 in the regulation of memory B cells.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19682311 B-CLL patients with high FCRL2 expression had a significantly longer treatment-free survival & overall survival than those with low FCRL2.
18802695 Down-regulation of FCRL2 is associated with acute lymphoblastic leukemia.
18704934 Fc receptor-like 1-5 molecules are similarly expressed in progressive and indolent clinical subtypes of B-cell chronic lymphocytic leukemia.
18314442 FCRL2 has robust predictive value for determining IGHV gene mutation status and clinical progression and thus may further improve prognostic definition in chronic lymphocytic leukemia.

AA Sequence

MLLWSLLVIFDAVTEQADSLTLVAPSSVFEGDSIVLKCQGEQNWKIQKMAYHKDNKELSVFKKFSDFLIQ      1 - 70
SAVLSDSGNYFCSTKGQLFLWDKTSNIVKIKVQELFQRPVLTASSFQPIEGGPVSLKCETRLSPQRLDVQ     71 - 140
LQFCFFRENQVLGSGWSSSPELQISAVWSEDTGSYWCKAETVTHRIRKQSLQSQIHVQRIPISNVSLEIR    141 - 210
APGGQVTEGQKLILLCSVAGGTGNVTFSWYREATGTSMGKKTQRSLSAELEIPAVKESDAGKYYCRADNG    211 - 280
HVPIQSKVVNIPVRIPVSRPVLTLRSPGAQAAVGDLLELHCEALRGSPPILYQFYHEDVTLGNSSAPSGG    281 - 350
GASFNLSLTAEHSGNYSCEANNGLGAQCSEAVPVSISGPDGYRRDLMTAGVLWGLFGVLGFTGVALLLYA    351 - 420
LFHKISGESSATNEPRGASRPNPQEFTYSSPTPDMEELQPVYVNVGSVDVDVVYSQVWSMQQPESSANIR    421 - 490
TLLENKDSQVIYSSVKKS                                                        491 - 508
//

Text Mined References (19)

PMID Year Title
25738996 2015 Expression Profile of Human Fc Receptor-Like 1, 2, and 4 Molecules in Peripheral Blood Mononuclear Cells of Patients with Hashimoto's Thyroiditis and Graves' Disease.
25416956 2014 A proteome-scale map of the human interactome network.
21068405 2010 FcR-like 2 Inhibition of B cell receptor-mediated activation of B cells.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19682311 2009 FCRL2 mRNA expression is inversely associated with clinical progression in chronic lymphocytic leukemia.
18802695 2009 Low representation of Fc receptor-like 1-5 molecules in leukemic cells from Iranian patients with acute lymphoblastic leukemia.
18704934 2008 Fc receptor-like 1-5 molecules are similarly expressed in progressive and indolent clinical subtypes of B-cell chronic lymphocytic leukemia.
18314442 2008 FCRL2 expression predicts IGHV mutation status and clinical progression in chronic lymphocytic leukemia.
17273841 2007 The first avian Ig-like Fc receptor family member combines features of mammalian FcR and FCRL.
16849395 2006 Expression pattern of the human FcRH/IRTA receptors in normal tissue and in B-chronic lymphocytic leukemia.
More...