Property Summary

NCBI Gene PubMed Count 20
PubMed Score 7.77
PubTator Score 8.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
interstitial cystitis 2.800 1.2e-02
nasopharyngeal carcinoma -1.600 1.4e-03
non primary Sjogren syndrome sicca -1.200 2.0e-02
osteosarcoma -3.396 4.1e-09
tuberculosis 1.800 1.0e-04
ulcerative colitis 1.400 1.4e-03

Gene RIF (8)

AA Sequence

MLLWSLLVIFDAVTEQADSLTLVAPSSVFEGDSIVLKCQGEQNWKIQKMAYHKDNKELSVFKKFSDFLIQ      1 - 70
SAVLSDSGNYFCSTKGQLFLWDKTSNIVKIKVQELFQRPVLTASSFQPIEGGPVSLKCETRLSPQRLDVQ     71 - 140
LQFCFFRENQVLGSGWSSSPELQISAVWSEDTGSYWCKAETVTHRIRKQSLQSQIHVQRIPISNVSLEIR    141 - 210
APGGQVTEGQKLILLCSVAGGTGNVTFSWYREATGTSMGKKTQRSLSAELEIPAVKESDAGKYYCRADNG    211 - 280
HVPIQSKVVNIPVRIPVSRPVLTLRSPGAQAAVGDLLELHCEALRGSPPILYQFYHEDVTLGNSSAPSGG    281 - 350
GASFNLSLTAEHSGNYSCEANNGLGAQCSEAVPVSISGPDGYRRDLMTAGVLWGLFGVLGFTGVALLLYA    351 - 420
LFHKISGESSATNEPRGASRPNPQEFTYSSPTPDMEELQPVYVNVGSVDVDVVYSQVWSMQQPESSANIR    421 - 490
TLLENKDSQVIYSSVKKS                                                        491 - 508
//

Text Mined References (20)

PMID Year Title