Property Summary

NCBI Gene PubMed Count 16
Grant Count 4
Funding $520,758
PubMed Score 14.90
PubTator Score 10.26

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
23749212 The kinesin KIF16B mediates apical transcytosis of transferrin receptor in AP-1B-deficient epithelia.
22449649 genome-wide significance in genes involved in synaptic signaling (KIF16B; p = 1.27E-08) and neurodevelopment (PAX5; p = 3.58E-08).
22357949 The tubule formations were dependent on microtubule interactions, and specifically controlled by Kif16b and dynein 1.
15882625 KIF16B, a kinesin-3, transports early endosomes to the plus end of microtubules in a process regulated by the small GTPase Rab5 and its effector.

AA Sequence

MASVKVAVRVRPMNRREKDLEAKFIIQMEKSKTTITNLKIPEGGTGDSGRERTKTFTYDFSFYSADTKSP      1 - 70
DYVSQEMVFKTLGTDVVKSAFEGYNACVFAYGQTGSGKSYTMMGNSGDSGLIPRICEGLFSRINETTRWD     71 - 140
EASFRTEVSYLEIYNERVRDLLRRKSSKTFNLRVREHPKEGPYVEDLSKHLVQNYGDVEELMDAGNINRT    141 - 210
TAATGMNDVSSRSHAIFTIKFTQAKFDSEMPCETVSKIHLVDLAGSERADATGATGVRLKEGGNINKSLV    211 - 280
TLGNVISALADLSQDAANTLAKKKQVFVPYRDSVLTWLLKDSLGGNSKTIMIATISPADVNYGETLSTLR    281 - 350
YANRAKNIINKPTINEDANVKLIRELRAEIARLKTLLAQGNQIALLDSPTALSMEEKLQQNEARVQELTK    351 - 420
EWTNKWNETQNILKEQTLALRKEGIGVVLDSELPHLIGIDDDLLSTGIILYHLKEGQTYVGRDDASTEQD    421 - 490
IVLHGLDLESEHCIFENIGGTVTLIPLSGSQCSVNGVQIVEATHLNQGAVILLGRTNMFRFNHPKEAAKL    491 - 560
REKRKSGLLSSFSLSMTDLSKSRENLSAVMLYNPGLEFERQQREELEKLESKRKLIEEMEEKQKSDKAEL    561 - 630
ERMQQEVETQRKETEIVQLQIRKQEESLKRRSFHIENKLKDLLAEKEKFEEERLREQQEIELQKKRQEEE    631 - 700
TFLRVQEELQRLKELNNNEKAEKFQIFQELDQLQKEKDEQYAKLELEKKRLEEQEKEQVMLVAHLEEQLR    701 - 770
EKQEMIQLLRRGEVQWVEEEKRDLEGIRESLLRVKEARAGGDEDGEELEKAQLRFFEFKRRQLVKLVNLE    771 - 840
KDLVQQKDILKKEVQEEQEILECLKCEHDKESRLLEKHDESVTDVTEVPQDFEKIKPVEYRLQYKERQLQ    841 - 910
YLLQNHLPTLLEEKQRAFEILDRGPLSLDNTLYQVEKEMEEKEEQLAQYQANANQLQKLQATFEFTANIA    911 - 980
RQEEKVRKKEKEILESREKQQREALERALARLERRHSALQRHSTLGMEIEEQRQKLASLNSGSREQSGLQ    981 - 1050
ASLEAEQEALEKDQERLEYEIQQLKQKIYEVDGVQKDHHGTLEGKVASSSLPVSAEKSHLVPLMDARINA   1051 - 1120
YIEEEVQRRLQDLHRVISEGCSTSADTMKDNEKLHNGTIQRKLKYERMVSRSLGANPDDLKDPIKISIPR   1121 - 1190
YVLCGQGKDAHFEFEVKITVLDETWTVFRRYSRFREMHKTLKLKYAELAALEFPPKKLFGNKDERVIAER   1191 - 1260
RSHLEKYLRDFFSVMLQSATSPLHINKVGLTLSKHTICEFSPFFKKGVFDYSSHGTG                1261 - 1317
//

Text Mined References (21)

PMID Year Title
23749212 2013 The kinesin KIF16B mediates apical transcytosis of transferrin receptor in AP-1B-deficient epithelia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23006423 2012 Genetic association with overall survival of taxane-treated lung cancer patients - a genome-wide association study in human lymphoblastoid cell lines followed by a clinical association study.
22449649 2012 Genome-wide association study of intelligence: additive effects of novel brain expressed genes.
22357949 2012 The fusion of early endosomes induces molecular-motor-driven tubule formation and fission.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21139019 2011 A pilot genome-wide association study shows genomic variants enriched in the non-tumor cells of patients with well-differentiated neuroendocrine tumors of the ileum.
20923765 2010 PTPD1 supports receptor stability and mitogenic signaling in bladder cancer cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17641687 2007 The structural basis of novel endosome anchoring activity of KIF16B kinesin.
More...