Property Summary

NCBI Gene PubMed Count 33
PubMed Score 34.33
PubTator Score 34.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Rheumatoid Arthritis 1.100 2.4e-03
osteosarcoma 2.856 5.3e-09
group 3 medulloblastoma -1.500 1.3e-03
medulloblastoma, large-cell -1.100 2.1e-05
lung cancer 1.500 4.3e-04
posterior fossa group B ependymoma -1.500 1.9e-06
psoriasis -1.200 5.2e-10
Pick disease 1.100 3.5e-04

Gene RIF (23)

PMID Text
26956659 SNX27 interaction with FAM21 is required for the precise localization of SNX27 at an endosomal subdomain.
26744382 SNX27 inhibits the Wnt regulated transcription activity of TCF/LEF. Our results suggested that SNX27 interacts with Frizzled receptors to regulate the endocytosis and stability of Fzds
26202251 The double knockdown of SNX17 and SNX27 results in a striking reduction of papillomavirus 16 infection due to interruption of their binding to the L2 viral protein.
25894286 SNX27 deficiency is now added to the growing list of neurodegenerative disorders associated with retromer dysfunction.
25472716 The results suggest that SNX27 undergoes dynamic partitioning between different membrane domains during immunological synapse assembly, and underscore the contribution of unique lipid interactions for SNX27 orchestration of cargo trafficking.
25437557 a function of SNX27 in regulating beta-amyloid (Abeta) generation by modulating gamma-secretase activity.
25278552 RNAi-mediated suppression of ANKRD50 phenocopies loss of SNX27-retromer function.
25136126 VPS26A binding increases the affinity of the SNX27 PDZ domain for PDZ- binding motifs by an order of magnitude, revealing cooperativity in cargo selection.
23563491 Direct interaction of the SNX27 PDZ domain with the retromer subunit VPS26 is necessary and sufficient to prevent lysosomal entry of SNX27 cargo.
23536889 Ras-association domain of sorting Nexin 27 is critical for regulating expression of GIRK potassium channels.
22411990 SNX27 interacts with MRP4 near the plasma membrane and promotes endocytosis of MRP4 and thereby negatively regulates its cell surface expression and transport function.
21926430 a model by which SNX27 regulates trafficking of beta-Pix to focal adhesions and thereby influences cell motility.
21602791 show that sorting nexin 27 (SNX27) serves as an essential adaptor protein linking beta2ARs to the retromer tubule
21303929 These results identify SNX27 as a PDZ-containing component of the T cell immunological synapse, and demonstrate a role for this protein in the regulation of the Ras-ERK pathway, suggesting a functional relationship between SNX27 and DGKzeta.
21300787 indicate that SNX27 may function to regulate endocytosis and/or endosomal sorting of NR2C
20733053 Results identify a discrete role of SNX27 in PDZ-directed recycling of a physiologically important signaling receptor, and extend the concept of cargo-specific molecular sorting in the recycling pathway.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18690037 regulation of Kir3 channels by SNX27 depends critically on the combination of Kir3 subunits
17828261 This study shows that SNX27 promotes the endosomal movement of Kir3 (or GIRK) channels, leading to reduced surface expression, increased degradation and smaller Kir3 potassium currents.
17577583 These results suggest that endosomal SNX27 may recruit CASP to orchestrate intracellular trafficking and/or signaling complexes.
17351151 These data support a previously unreported role for diacylglycerol kinase zeta in the modulation of membrane trafficking, which may also help to define SNX27 function.
15466885 SNX27a redirects part of the 5-HT4(a)R to early endosomes.
15121882 Overexpression of SNX17 in mammalian cells promotes the endocytosis of P-selectin from the plasma membrane and inhibits its movement into lysosomes.

AA Sequence

MADEDGEGIHPSAPHRNGGGGGGGGSGLHCAGNGGGGGGGPRVVRIVKSESGYGFNVRGQVSEGGQLRSI      1 - 70
NGELYAPLQHVSAVLPGGAADRAGVRKGDRILEVNHVNVEGATHKQVVDLIRAGEKELILTVLSVPPHEA     71 - 140
DNLDPSDDSLGQSFYDYTEKQAVPISVPRYKHVEQNGEKFVVYNVYMAGRQLCSKRYREFAILHQNLKRE    141 - 210
FANFTFPRLPGKWPFSLSEQQLDARRRGLEEYLEKVCSIRVIGESDIMQEFLSESDENYNGVSDVELRVA    211 - 280
LPDGTTVTVRVKKNSTTDQVYQAIAAKVGMDSTTVNYFALFEVISHSFVRKLAPNEFPHKLYIQNYTSAV    281 - 350
PGTCLTIRKWLFTTEEEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSYQLQKLYEQRKMVMYLNMLRT    351 - 420
CEGYNEIIFPHCACDSRRKGHVITAISITHFKLHACTEEGQLENQVIAFEWDEMQRWDTDEEGMAFCFEY    421 - 490
ARGEKKPRWVKIFTPYFNYMHECFERVFCELKWRKENIFQMARSQQRDVAT                       491 - 541
//

Text Mined References (39)

PMID Year Title
27385586 2016 Parkinson Disease-linked Vps35 R524W Mutation Impairs the Endosomal Association of Retromer and Induces ?-Synuclein Aggregation.
26956659 2016 FAM21 directs SNX27-retromer cargoes to the plasma membrane by preventing transport to the Golgi apparatus.
26744382 2016 Sorting nexin 27 interacts with Fzd7 and mediates Wnt signalling.
26202251 2015 A Novel PDZ Domain Interaction Mediates the Binding between Human Papillomavirus 16 L2 and Sorting Nexin 27 and Modulates Virion Trafficking.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25894286 2015 A defect in the retromer accessory protein, SNX27, manifests by infantile myoclonic epilepsy and neurodegeneration.
25472716 2015 Phosphoinositide binding by the SNX27 FERM domain regulates its localization at the immune synapse of activated T-cells.
25437557 2014 Sorting nexin 27 regulates A? production through modulating ?-secretase activity.
25278552 2014 Identification of molecular heterogeneity in SNX27-retromer-mediated endosome-to-plasma-membrane recycling.
25136126 2014 A unique PDZ domain and arrestin-like fold interaction reveals mechanistic details of endocytic recycling by SNX27-retromer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23563491 2013 A global analysis of SNX27-retromer assembly and cargo specificity reveals a function in glucose and metal ion transport.
23536889 2013 Ras-association domain of sorting Nexin 27 is critical for regulating expression of GIRK potassium channels.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22411990 2012 Sorting nexin 27 interacts with multidrug resistance-associated protein 4 (MRP4) and mediates internalization of MRP4.
21926430 2011 Sorting nexin 27 protein regulates trafficking of a p21-activated kinase (PAK) interacting exchange factor (?-Pix)-G protein-coupled receptor kinase interacting protein (GIT) complex via a PDZ domain interaction.
21602791 2011 SNX27 mediates retromer tubule entry and endosome-to-plasma membrane trafficking of signalling receptors.
21303929 2011 Translocation dynamics of sorting nexin 27 in activated T cells.
21300787 2011 Deficiency of sorting nexin 27 (SNX27) leads to growth retardation and elevated levels of N-methyl-D-aspartate receptor 2C (NR2C).
21269460 2011 Initial characterization of the human central proteome.
20733053 2010 SNX27 mediates PDZ-directed sorting from endosomes to the plasma membrane.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19555689 2009 MCC, a new interacting protein for Scrib, is required for cell migration in epithelial cells.
18690037 Subunit-specific regulation of Kir3 channels by sorting nexin 27.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17828261 2007 A unique sorting nexin regulates trafficking of potassium channels via a PDZ domain interaction.
17644068 2007 Polarization of endosomal SNX27 in migrating and tumor-engaged natural killer cells.
17577583 2007 Sorting nexin 27 interacts with the Cytohesin associated scaffolding protein (CASP) in lymphocytes.
17351151 2007 Proteomics identification of sorting nexin 27 as a diacylglycerol kinase zeta-associated protein: new diacylglycerol kinase roles in endocytic recycling.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15466885 2004 New sorting nexin (SNX27) and NHERF specifically interact with the 5-HT4a receptor splice variant: roles in receptor targeting.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12461558 2002 Sorting out the cellular functions of sorting nexins.
11485546 2001 A large family of endosome-localized proteins related to sorting nexin 1.
9455484 1997 Characterization of cDNA clones in size-fractionated cDNA libraries from human brain.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.