Property Summary

NCBI Gene PubMed Count 33
Grant Count 48
R01 Count 26
Funding $21,672,990.31
PubMed Score 34.33
PubTator Score 34.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Rheumatoid Arthritis 1.100 0.002
osteosarcoma 2.856 0.000
group 3 medulloblastoma -1.500 0.001
medulloblastoma, large-cell -1.100 0.000
lung cancer 1.500 0.000
posterior fossa group B ependymoma -1.500 0.000
psoriasis -1.200 0.000
Pick disease 1.100 0.000

Gene RIF (23)

PMID Text
26956659 SNX27 interaction with FAM21 is required for the precise localization of SNX27 at an endosomal subdomain.
26744382 SNX27 inhibits the Wnt regulated transcription activity of TCF/LEF. Our results suggested that SNX27 interacts with Frizzled receptors to regulate the endocytosis and stability of Fzds
26202251 The double knockdown of SNX17 and SNX27 results in a striking reduction of papillomavirus 16 infection due to interruption of their binding to the L2 viral protein.
25894286 SNX27 deficiency is now added to the growing list of neurodegenerative disorders associated with retromer dysfunction.
25472716 The results suggest that SNX27 undergoes dynamic partitioning between different membrane domains during immunological synapse assembly, and underscore the contribution of unique lipid interactions for SNX27 orchestration of cargo trafficking.
25437557 a function of SNX27 in regulating beta-amyloid (Abeta) generation by modulating gamma-secretase activity.
25278552 RNAi-mediated suppression of ANKRD50 phenocopies loss of SNX27-retromer function.
25136126 VPS26A binding increases the affinity of the SNX27 PDZ domain for PDZ- binding motifs by an order of magnitude, revealing cooperativity in cargo selection.
23563491 Direct interaction of the SNX27 PDZ domain with the retromer subunit VPS26 is necessary and sufficient to prevent lysosomal entry of SNX27 cargo.
23536889 Ras-association domain of sorting Nexin 27 is critical for regulating expression of GIRK potassium channels.
More...

AA Sequence

MADEDGEGIHPSAPHRNGGGGGGGGSGLHCAGNGGGGGGGPRVVRIVKSESGYGFNVRGQVSEGGQLRSI      1 - 70
NGELYAPLQHVSAVLPGGAADRAGVRKGDRILEVNHVNVEGATHKQVVDLIRAGEKELILTVLSVPPHEA     71 - 140
DNLDPSDDSLGQSFYDYTEKQAVPISVPRYKHVEQNGEKFVVYNVYMAGRQLCSKRYREFAILHQNLKRE    141 - 210
FANFTFPRLPGKWPFSLSEQQLDARRRGLEEYLEKVCSIRVIGESDIMQEFLSESDENYNGVSDVELRVA    211 - 280
LPDGTTVTVRVKKNSTTDQVYQAIAAKVGMDSTTVNYFALFEVISHSFVRKLAPNEFPHKLYIQNYTSAV    281 - 350
PGTCLTIRKWLFTTEEEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSYQLQKLYEQRKMVMYLNMLRT    351 - 420
CEGYNEIIFPHCACDSRRKGHVITAISITHFKLHACTEEGQLENQVIAFEWDEMQRWDTDEEGMAFCFEY    421 - 490
ARGEKKPRWVKIFTPYFNYMHECFERVFCELKWRKENIFQMARSQQRDVAT                       491 - 541
//

Text Mined References (39)

PMID Year Title
27385586 2016 Parkinson Disease-linked Vps35 R524W Mutation Impairs the Endosomal Association of Retromer and Induces ?-Synuclein Aggregation.
26956659 2016 FAM21 directs SNX27-retromer cargoes to the plasma membrane by preventing transport to the Golgi apparatus.
26744382 2016 Sorting nexin 27 interacts with Fzd7 and mediates Wnt signalling.
26202251 2015 A Novel PDZ Domain Interaction Mediates the Binding between Human Papillomavirus 16 L2 and Sorting Nexin 27 and Modulates Virion Trafficking.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25894286 2015 A defect in the retromer accessory protein, SNX27, manifests by infantile myoclonic epilepsy and neurodegeneration.
25472716 2015 Phosphoinositide binding by the SNX27 FERM domain regulates its localization at the immune synapse of activated T-cells.
25437557 2014 Sorting nexin 27 regulates A? production through modulating ?-secretase activity.
25278552 2014 Identification of molecular heterogeneity in SNX27-retromer-mediated endosome-to-plasma-membrane recycling.
25136126 2014 A unique PDZ domain and arrestin-like fold interaction reveals mechanistic details of endocytic recycling by SNX27-retromer.
More...