Property Summary

NCBI Gene PubMed Count 5
PubMed Score 16.53
PubTator Score 11.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adrenocortical carcinoma 1.029 2.8e-03
adult high grade glioma 1.700 6.3e-05
Astrocytoma, Pilocytic 1.400 1.2e-05
atypical teratoid / rhabdoid tumor 1.300 3.4e-04
ependymoma 1.300 2.9e-06
glioblastoma 2.100 6.7e-10
group 3 medulloblastoma 2.900 2.8e-06
intraductal papillary-mucinous neoplasm ... 1.600 2.2e-02
medulloblastoma, large-cell 1.800 1.3e-04
primitive neuroectodermal tumor 1.900 7.2e-04
psoriasis 1.200 6.5e-17

Gene RIF (1)

AA Sequence

MKLHCEVEVISRHLPALGLRNRGKGVRAVLSLCQQTSRSQPPVRAFLLISTLKDKRGTRYELRENIEQFF      1 - 70
TKFVDEGKATVRLKEPPVDICLSKAISSSLKGFLSAMRLAHRGCNVDTPVSTLTPVKTSEFENFKTKMVI     71 - 140
TSKKDYPLSKNFPYSLEHLQTSYCGLVRVDMRMLCLKSLRKLDLSHNHIKKLPATIGDLIHLQELNLNDN    141 - 210
HLESFSVALCHSTLQKSLRSLDLSKNKIKALPVQFCQLQELKNLKLDDNELIQFPCKIGQLINLRFLSAA    211 - 280
RNKLPFLPSEFRNLSLEYLDLFGNTFEQPKVLPVIKLQAPLTLLESSARTILHNRIPYGSHIIPFHLCQD    281 - 350
LDTAKICVCGRFCLNSFIQGTTTMNLHSVAHTVVLVDNLGGTEAPIISYFCSLGCYVNSSDMLK          351 - 414
//

Text Mined References (7)

PMID Year Title