Property Summary

NCBI Gene PubMed Count 5
PubMed Score 16.29
PubTator Score 11.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 6.49526683401117E-17
glioblastoma 5572 6.67730317774005E-10
posterior fossa group A ependymoma 1511 2.80382261446247E-7
atypical teratoid/rhabdoid tumor 1095 8.55924597979563E-7
pediatric high grade glioma 2712 9.93457867342846E-7
group 3 medulloblastoma 2254 2.79525942149546E-6
pilocytic astrocytoma 3086 9.15909621958659E-6
medulloblastoma, large-cell 6234 1.31443389642658E-4
primitive neuroectodermal tumor 3031 7.19802029559061E-4
adrenocortical carcinoma 1427 0.00281643612867732
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0221509357786547
Disease Target Count Z-score Confidence
Vitiligo 71 4.576 2.3
Addison's disease 29 3.627 1.8
Trichomoniasis 9 3.057 1.5

Expression

Synonym

Accession Q96L50 A5D6X3 B4DDE0 Q52M24 Q86SZ1 Q8N6H9
Symbols LRR-1
PPIL5
4-1BBLRR

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid

Gene RIF (1)

PMID Text
21074724 Results identify the CRL2(LRR-1) ubiquitin ligase as a conserved regulator of Cip/Kip CKIs that promotes the degradation of C. elegans CKI-1 and human p21.

AA Sequence

MKLHCEVEVISRHLPALGLRNRGKGVRAVLSLCQQTSRSQPPVRAFLLISTLKDKRGTRYELRENIEQFF      1 - 70
TKFVDEGKATVRLKEPPVDICLSKAISSSLKGFLSAMRLAHRGCNVDTPVSTLTPVKTSEFENFKTKMVI     71 - 140
TSKKDYPLSKNFPYSLEHLQTSYCGLVRVDMRMLCLKSLRKLDLSHNHIKKLPATIGDLIHLQELNLNDN    141 - 210
HLESFSVALCHSTLQKSLRSLDLSKNKIKALPVQFCQLQELKNLKLDDNELIQFPCKIGQLINLRFLSAA    211 - 280
RNKLPFLPSEFRNLSLEYLDLFGNTFEQPKVLPVIKLQAPLTLLESSARTILHNRIPYGSHIIPFHLCQD    281 - 350
LDTAKICVCGRFCLNSFIQGTTTMNLHSVAHTVVLVDNLGGTEAPIISYFCSLGCYVNSSDMLK          351 - 414
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21074724 2010 CRL2(LRR-1) targets a CDK inhibitor for cell cycle control in C. elegans and actin-based motility regulation in human cells.
15601820 2004 VHL-box and SOCS-box domains determine binding specificity for Cul2-Rbx1 and Cul5-Rbx2 modules of ubiquitin ligases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11804328 2001 A novel leucine-rich repeat protein (LRR-1): potential involvement in 4-1BB-mediated signal transduction.