Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.62
PubTator Score 13.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
periodontitis 293 1.9e-22
non-small cell lung cancer 2890 1.4e-07
interstitial cystitis 2312 1.7e-02

Expression

  Differential Expression (3)

Disease log2 FC p
interstitial cystitis -1.900 1.7e-02
non-small cell lung cancer 1.839 1.4e-07
periodontitis -1.100 1.9e-22

Gene RIF (3)

AA Sequence

MFLAKALLEGADRGLGEALGGLFGGGGQRREGGGRNIGGIVGGIVNFISEAAAAQYTPEPPPTQQHFTSV      1 - 70
EASESEEVRRFRQQFTQLAGPDMEVGATDLMNILNKVLSKHKDLKTDGFSLDTCRSIVSVMDSDTTGKLG     71 - 140
FEEFKYLWNNIKKWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGDMDFNNFI    141 - 210
SCLVRLDAMFRAFKSLDRDRDGLIQVSIKEWLQLTMYS                                    211 - 248
//

Text Mined References (10)

PMID Year Title