Property Summary

NCBI Gene PubMed Count 28
Grant Count 5
R01 Count 5
Funding $193,230.67
PubMed Score 37.94
PubTator Score 28.63

Knowledge Summary

Patent (2,698)

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell -1.100 0.001
adult high grade glioma -1.400 0.000
ovarian cancer 1.500 0.000

Synonym

Accession Q96L34 Q8NG37 Q96JG7 Q96SQ2 Q9BYD8
Symbols MARK4L
MARK4S
MARKL1
PAR-1D
MARKL1L

Gene

PDB

5ES1  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (15)

PMID Text
26346160 Atypical PKC phosphorylates serine-threonine residues of MARK4.
25578778 Suggest role for polypyrimidine-tract binding protein in regulating alternative splicing of MARK4 in gliomas.
25123532 MARK4 is a key component in the regulation of microtubule dynamics and has major role in cell cycle progression, particularly at the G1/S transition.
24763618 Molecular dynamic simulation data predicted the three dimensional structure for the kinase domain of MARK4 and its structural properties.
23666762 A strong and significant elevation of MARK4 expression and MARK4-tau interactions in AD brains correlates with the Braak stages of the disease, suggesting that the MARK4-tau interactions are of functional importance in the progression of AD.
23400999 MARK4 is a critical positive regulator of early steps in ciliogenesis.
23184942 MARK4 is a new negative regulator of mTORC1
22506312 Even though an association of the polymorphisms rs2850328 and rs2395 and breast cancer was not detected in our case-control study population, other variants within the PPP3CA and MARK4 genes may still be associated with breast cancer.
22156016 The balance between the MARK4 isoforms is carefully guarded during neural differentiation but may be subverted in gliomagenesis.
20634891 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSSRTVLAPGNDRNSDTHGTLGSGRSSDKGPSWSSRSLGARCRNSIASCPEEQPHVGNYRLLRTIGKGNF      1 - 70
AKVKLARHILTGREVAIKIIDKTQLNPSSLQKLFREVRIMKGLNHPNIVKLFEVIETEKTLYLVMEYASA     71 - 140
GEVFDYLVSHGRMKEKEARAKFRQIVSAVHYCHQKNIVHRDLKAENLLLDAEANIKIADFGFSNEFTLGS    141 - 210
KLDTFCGSPPYAAPELFQGKKYDGPEVDIWSLGVILYTLVSGSLPFDGHNLKELRERVLRGKYRVPFYMS    211 - 280
TDCESILRRFLVLNPAKRCTLEQIMKDKWINIGYEGEELKPYTEPEEDFGDTKRIEVMVGMGYTREEIKE    281 - 350
SLTSQKYNEVTATYLLLGRKTEEGGDRGAPGLALARVRAPSDTTNGTSSSKGTSHSKGQRSSSSTYHRQR    351 - 420
RHSDFCGPSPAPLHPKRSPTSTGEAELKEERLPGRKASCSTAGSGSRGLPPSSPMVSSAHNPNKAEIPER    421 - 490
RKDSTSTPNNLPPSMMTRRNTYVCTERPGAERPSLLPNGKENSSGTPRVPPASPSSHSLAPPSGERSRLA    491 - 560
RGSTIRSTFHGGQVRDRRAGGGGGGGVQNGPPASPTLAHEAAPLPAGRPRPTTNLFTKLTSKLTRRVADE    561 - 630
PERIGGPEVTSCHLPWDQTETAPRLLRFPWSVKLTSSRPPEALMAALRQATAAARCRCRQPQPFLLACLH    631 - 700
GGAGGPEPLSHFEVEVCQLPRPGLRGVLFRRVAGTALAFRTLVTRISNDLEL                      701 - 752
//

Text Mined References (32)

PMID Year Title
26346160 2015 Atypical PKC phosphorylates microtubule affinity-regulating kinase 4 in vitro.
25578778 2015 Suggestive evidence on the involvement of polypyrimidine-tract binding protein in regulating alternative splicing of MAP/microtubule affinity-regulating kinase 4 in glioma.
25123532 Microtubule-associated protein/microtubule affinity-regulating kinase 4 (MARK4) plays a role in cell cycle progression and cytoskeletal dynamics.
24763618 2014 The structural analysis of MARK4 and the exploration of specific inhibitors for the MARK family: a computational approach to obstruct the role of MARK4 in prostate cancer progression.
23666762 2013 Role of individual MARK isoforms in phosphorylation of tau at Ser²?² in Alzheimer's disease.
23400999 2013 The microtubule affinity regulating kinase MARK4 promotes axoneme extension during early ciliogenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23184942 2013 Microtubule-associated protein/microtubule affinity-regulating kinase 4 (MARK4) is a negative regulator of the mammalian target of rapamycin complex 1 (mTORC1).
22506312 2011 Investigation of two Wnt signalling pathway single nucleotide polymorphisms in a breast cancer-affected Australian population.
22156016 2011 Differential signature of the centrosomal MARK4 isoforms in glioma.
More...