Property Summary

Ligand Count 2
NCBI Gene PubMed Count 30
PubMed Score 42.60
PubTator Score 28.63

Knowledge Summary

Patent (2,698)

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.3e-07
adult high grade glioma 3801 3.4e-05
medulloblastoma, large-cell 6241 1.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (3)

Disease log2 FC p
adult high grade glioma -1.200 3.4e-05
medulloblastoma, large-cell -1.100 1.3e-03
ovarian cancer 1.500 1.3e-07

Protein-protein Interaction (1)

Gene RIF (17)

AA Sequence

MSSRTVLAPGNDRNSDTHGTLGSGRSSDKGPSWSSRSLGARCRNSIASCPEEQPHVGNYRLLRTIGKGNF      1 - 70
AKVKLARHILTGREVAIKIIDKTQLNPSSLQKLFREVRIMKGLNHPNIVKLFEVIETEKTLYLVMEYASA     71 - 140
GEVFDYLVSHGRMKEKEARAKFRQIVSAVHYCHQKNIVHRDLKAENLLLDAEANIKIADFGFSNEFTLGS    141 - 210
KLDTFCGSPPYAAPELFQGKKYDGPEVDIWSLGVILYTLVSGSLPFDGHNLKELRERVLRGKYRVPFYMS    211 - 280
TDCESILRRFLVLNPAKRCTLEQIMKDKWINIGYEGEELKPYTEPEEDFGDTKRIEVMVGMGYTREEIKE    281 - 350
SLTSQKYNEVTATYLLLGRKTEEGGDRGAPGLALARVRAPSDTTNGTSSSKGTSHSKGQRSSSSTYHRQR    351 - 420
RHSDFCGPSPAPLHPKRSPTSTGEAELKEERLPGRKASCSTAGSGSRGLPPSSPMVSSAHNPNKAEIPER    421 - 490
RKDSTSTPNNLPPSMMTRRNTYVCTERPGAERPSLLPNGKENSSGTPRVPPASPSSHSLAPPSGERSRLA    491 - 560
RGSTIRSTFHGGQVRDRRAGGGGGGGVQNGPPASPTLAHEAAPLPAGRPRPTTNLFTKLTSKLTRRVADE    561 - 630
PERIGGPEVTSCHLPWDQTETAPRLLRFPWSVKLTSSRPPEALMAALRQATAAARCRCRQPQPFLLACLH    631 - 700
GGAGGPEPLSHFEVEVCQLPRPGLRGVLFRRVAGTALAFRTLVTRISNDLEL                      701 - 752
//

Text Mined References (34)

PMID Year Title