1. Home
  2. Targets
  3. enzyme modulator
  4. G-protein
  5. small GTPase
  6. Rho-related GTP-binding protein RhoV

Tbio Rho-related GTP-binding protein RhoV

Plays a role in the control of the actin cytoskeleton via activation of the JNK pathway.

 Comments

Property Summary

NCBI Gene PubMed Count 11
Grant Count 5
R01 Count 5
Funding $128,269.54
PubMed Score 14.88
PubTator Score 15.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (9)

Disease Z-score Confidence
adult high grade glioma 2,148
atypical teratoid / rhabdoid tumor 4,369
ductal carcinoma in situ 1,745
fibroadenoma 557
glioblastoma 5,572
interstitial cystitis 2,299
lung adenocarcinoma 2,713
nasopharyngeal carcinoma 1,056
non-small cell lung cancer 2,798

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 0.000
glioblastoma -1.200 0.000
non-small cell lung cancer 1.693 0.000
fibroadenoma 1.700 0.048
interstitial cystitis -1.300 0.000
adult high grade glioma -1.200 0.001
lung adenocarcinoma 1.800 0.000
nasopharyngeal carcinoma -1.100 0.001
ductal carcinoma in situ 1.100 0.012

Synonym

Accession Q96L33 Q2KHQ5 Q8TDW6
Symbols CHP
ARHV
WRCH2

Gene

RHOV

PANTHER Protein Class (3)

 Grant Application (5)

 GO Function (2)

 GO Component (3)

 GO Process (2)

 Compartment GO Term (27)

See all...

Pathway (4)

 UniProt Keyword (12)

See all...

Gene RIF (5)

PMID Text
24388711 Authors propose that the RHOV gene could be validated as a diagnostic or prognostic marker for NSCLC, and that observed overexpression of RHOV might contribute to tumorigenesis.
22339630 CDC42 homologous protein does not enhance the level of Ser60 phosphorylation in Pak6. (RHO V protein)
17355222 Results demonstrate a novel mechanism of signal termination mediated by the Rho-family GTPases Chp and Cdc42, which results in ubiquitin-mediated degradation of one of their direct effectors, Pak1.
15664990 Data suggest that Chp is implicated in cell transformation, and the unique amino and carboxyl termini of Chp represent atypical mechanisms of regulation of Rho GTPase function.
11956592 cloning and characterization of WRCH2 on human chromosome 15q15

AA Sequence 

MPPRELSEAEPPPLRAPTPPPRRRSAPPELGIKCVLVGDGAVGKSSLIVSYTCNGYPARYRPTALDTFSV      1 - 70
QVLVDGAPVRIELWDTAGQEDFDRLRSLCYPDTDVFLACFSVVQPSSFQNITEKWLPEIRTHNPQAPVLL     71 - 140
VGTQADLRDDVNVLIQLDQGGREGPVPQPQAQGLAEKIRACCYLECSALTQKNLKEVFDSAILSAIEHKA    141 - 210
RLEKKLNAKGVRTLSRCRWKKFFCFV                                                211 - 236
//

Text Mined References (13)

PMID Year Title
24388711 2013 The RHOV gene is overexpressed in human non-small cell lung cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22339630 2012 Pak6 protein kinase is a novel effector of an atypical Rho family GTPase Chp/RhoV.
17355222 2007 Autophosphorylation-dependent degradation of Pak1, triggered by the Rho-family GTPase, Chp.
17035353 2007 Evolution of the Rho family of ras-like GTPases in eukaryotes.
16752908 2006 Structural insight into the binding diversity between the human Nck2 SH3 domains and proline-rich proteins.
15664990 2005 Critical and distinct roles of amino- and carboxyl-terminal sequences in regulation of the biological activity of the Chp atypical Rho GTPase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...