Property Summary

NCBI Gene PubMed Count 7
PubMed Score 142.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Scurvy 10 3.052 1.5

Synonym

Accession Q96L14
Symbols FAM68B
CEP170L
KIAA0470L

Gene

PANTHER Protein Class (2)

 GWAS Trait (1)

AA Sequence

MPTSSSFKHRIKEQEDYIRDWTAHREEIARISQDLALIAREINDVAGEIDSVTSSGTAPSTTLVDRVFDE      1 - 70
SLNFQKIPPLVHSKTPEGNNGRSGDPRPQAAEPPDHLTITRRRTWSRDEVMGDNLLLSSVFQFSKKIRQS     71 - 140
IDKTAGKIRILFKDKDRNWDDIESKLRAESEVPIVKTSSMEISSILQELKRVEKQLQAINAMIDPDGTLE    141 - 210
ALNNMGFPSAMLPSPPKQKSSPVNNHHSPGQTPTLGQPEARALHPAAVSAAAEFENAESEADFSIHFNRV    211 - 280
NPDGEEEDVTVHK                                                             281 - 293
//

Text Mined References (9)

PMID Year Title