Property Summary

NCBI Gene PubMed Count 9
Grant Count 19
R01 Count 12
Funding $872,327.95
PubMed Score 10.69
PubTator Score 23.02

Knowledge Summary

Patent

No data available

Gene RIF (3)

PMID Text
26252478 ADAM2, CALR3 and SAGE1 cancer/testis antigens are not promising targets for immunotherapy of breast and lung cancer.
21590275 Calreticulin-2 is localized in the lumen of the endoplasmic reticulum but is not a Ca2+ -binding protein.
17975137 CRT2 is a novel cancer-testis antigen frequently expressed in various cancers

AA Sequence

MARALVQLWAICMLRVALATVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQ      1 - 70
NGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFD     71 - 140
IKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETS    141 - 210
PAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKM    211 - 280
KNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKE    281 - 350
EMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL                                        351 - 384
//

Text Mined References (12)

PMID Year Title
26252478 2015 Lack of ADAM2, CALR3 and SAGE1 Cancer/Testis Antigen Expression in Lung and Breast Cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21738480 2011 Multiple loci are associated with white blood cell phenotypes.
21590275 2011 Calreticulin-2 is localized in the lumen of the endoplasmic reticulum but is not a Ca2+ -binding protein.
17975137 2007 Identification of a novel cancer-testis antigen CRT2 frequently expressed in various cancers using representational differential analysis.
17655857 2007 Genetic screening of calcium regulation genes in familial hypertrophic cardiomyopathy.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...