Property Summary

NCBI Gene PubMed Count 9
PubMed Score 11.89
PubTator Score 23.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
CARDIOMYOPATHY, FAMILIAL HYPERTROPHIC, 19 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Hypertrophic Cardiomyopathy 117 0.0 5.0
Disease Target Count Z-score Confidence
Cardiomyopathy 116 0.0 4.0

Expression

Gene RIF (3)

AA Sequence

MARALVQLWAICMLRVALATVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQ      1 - 70
NGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFD     71 - 140
IKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETS    141 - 210
PAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKM    211 - 280
KNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKE    281 - 350
EMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL                                        351 - 384
//

Text Mined References (12)

PMID Year Title