Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.39
PubTator Score 1.38

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
breast carcinoma 1.800 1.1e-03
fibroadenoma 1.800 3.5e-03
interstitial cystitis 1.500 9.5e-03
osteosarcoma -2.706 5.5e-06
pancreatic ductal adenocarcinoma liver m... -1.549 3.3e-03

Gene RIF (2)

AA Sequence

MRWAAATLRGKARPRGRAGVTTPAPGNRTGTCAKLRLPPQATFQVLRGNGASVGTVLMFRCPSNHQMVGS      1 - 70
GLLTCTWKGSIAEWSSGSPVCKLVPPHETFGFKVAVIASIVSCAIILLMSMAFLTCCLLKCVKKSKRRRS     71 - 140
NRSAQLWSQLKDEDLETVQAAYLGLKHFNKPVSGPSQAHDNHSFTTDHGESTSKLASVTRSVDKDPGIPR    141 - 210
ALSLSGSSSSPQAQVMVHMANPRQPLPASGLATGMPQQPAAYALG                             211 - 255
//

Text Mined References (8)

PMID Year Title