Property Summary

NCBI Gene PubMed Count 7
Grant Count 2
Funding $37,400
PubMed Score 2.39
PubTator Score 1.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -2.706 0.000
pancreatic ductal adenocarcinoma liver m... -1.549 0.003
breast carcinoma 1.800 0.001
fibroadenoma 1.800 0.004
interstitial cystitis 1.500 0.010

Gene RIF (2)

PMID Text
26745129 High expression of SUSD3 is associated with breast cancer.
24413080 Data indicate that sushi domain containing 3 (SUSD3) is a promoter of estrogen-dependent cell proliferation and regulator of cell-cell and cell-substrate interactions and migration in breast cancer.

AA Sequence

MRWAAATLRGKARPRGRAGVTTPAPGNRTGTCAKLRLPPQATFQVLRGNGASVGTVLMFRCPSNHQMVGS      1 - 70
GLLTCTWKGSIAEWSSGSPVCKLVPPHETFGFKVAVIASIVSCAIILLMSMAFLTCCLLKCVKKSKRRRS     71 - 140
NRSAQLWSQLKDEDLETVQAAYLGLKHFNKPVSGPSQAHDNHSFTTDHGESTSKLASVTRSVDKDPGIPR    141 - 210
ALSLSGSSSSPQAQVMVHMANPRQPLPASGLATGMPQQPAAYALG                             211 - 255
//

Text Mined References (8)

PMID Year Title
26745129 2015 Expression and Clinical Significance of Sushi Domain- Containing Protein 3 (SUSD3) and Insulin-like Growth Factor-I Receptor (IGF-IR) in Breast Cancer.
24413080 2015 Estrogen-dependent sushi domain containing 3 regulates cytoskeleton organization and migration in breast cancer cells.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.