Property Summary

NCBI Gene PubMed Count 7
Grant Count 1
Funding $6,675.75
PubMed Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Amyotrophic Lateral Sclerosis 431 1.0

Expression

Synonym

Accession Q96KX1
Symbols

Gene

 Grant Application (1)

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAYGVPRKNTVKTILRGSCYNVQEPWDIALLAKTWSTNLANIKLPFLEEISFGGSVQLTKCTTIKDGLLP      1 - 70
SAESIKLEREYEVKRLCKLKCQENTSKEIQLLLRERPAGLRRPLPSK                            71 - 117
//

Text Mined References (7)

PMID Year Title
23568457 2013 Genetic variants associated with disordered eating.
22470424 2012 A high-density genome-wide association screen of sporadic ALS in US veterans.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.