Property Summary

NCBI Gene PubMed Count 6
PubMed Score 6.89
PubTator Score 6.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 5.0e-03
Disease Target Count Z-score Confidence
Schizophrenia 1160 0.0 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 5.0e-03

AA Sequence

MKASVVLSLLGYLVVPSGAYILGRCTVAKKLHDGGLDYFEGYSLENWVCLAYFESKFNPMAIYENTREGY      1 - 70
TGFGLFQMRGSDWCGDHGRNRCHMSCSALLNPNLEKTIKCAKTIVKGKEGMGAWPTWSRYCQYSDTLARW     71 - 140
LDGCKL                                                                    141 - 146
//

Text Mined References (7)

PMID Year Title