Property Summary

NCBI Gene PubMed Count 6
PubMed Score 6.98
PubTator Score 6.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Schizophrenia 501 1.0
psoriasis 6,685

AA Sequence

MKASVVLSLLGYLVVPSGAYILGRCTVAKKLHDGGLDYFEGYSLENWVCLAYFESKFNPMAIYENTREGY      1 - 70
TGFGLFQMRGSDWCGDHGRNRCHMSCSALLNPNLEKTIKCAKTIVKGKEGMGAWPTWSRYCQYSDTLARW     71 - 140
LDGCKL                                                                    141 - 146
//

Text Mined References (6)

PMID Year Title
21630459 2011 Proteomic characterization of the human sperm nucleus.
21107309 2011 Genome-wide pharmacogenomic study of neurocognition as an indicator of antipsychotic treatment response in schizophrenia.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16014814 2005 Molecular cloning and characterization of three novel lysozyme-like genes, predominantly expressed in the male reproductive system of humans, belonging to the c-type lysozyme/alpha-lactalbumin family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.