Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q96KW9 Q5T8L1
Symbols C13orf28

Gene

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAVSQGDGTLCFVLLLCCWQETELRPRTVIPGSPTEIPFSSKQEDMSELLDEILVQEILDLNKTTPSEMP      1 - 70
STASTLSTPLHAGIDENYQAGGSENYHELLENLQFSPGIEVKISNDEANANANLHGDPSENYRGPQVSPG     71 - 140
SEKSVSSKEKNSKNTQYENLSILDQILQNIGRSSGNIFHKEQQRTSAQRRSQGSQ                   141 - 195
//

Text Mined References (6)

PMID Year Title
22495889 2012 Identification of a new mouse sperm acrosome-associated protein.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.