Property Summary

NCBI Gene PubMed Count 7
PubMed Score 155.00
PubTator Score 20.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Thalassemia 53 3.826 1.9
Cancer 2499 3.406 1.7
Anemia 365 3.305 1.7

Expression

Synonym

Accession Q96KT7 A2RRL6
Symbols AMAC
AMAC1L2

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA Inparanoid

Gene RIF (4)

AA Sequence

MAGSHPYFNLPDSTHPSPPSAPPSLRWHQRCQPSGATNGLLVALLGGGLPAGFVGPLSRMAYQGSNLPSL      1 - 70
ELLICRCLFHLPIALLLKLRGDPLLGPPDIRGWACFCALLNVLSIGCAYSAVQVVPAGNAATVRKGSSTV     71 - 140
CSAVLTLCLESQGLGGYEWCGLLGSILGLIIILGPGLWTLQEGTTGVYTTLGYVQAFLGGLALSLGLLVY    141 - 210
RSLHFPSCLPTVAFLSGLVGLLGCVPGLFVLQTPVLPSDLLSWSCVGAEGILALVSFTCVGYAVTKAHPA    211 - 280
LVCAVLHSEVVVALILQYYMLHETVALSDIMGAGVVLGSIAIITARNLSCERTGKVEE                281 - 338
//

Text Mined References (8)

PMID Year Title