Property Summary

NCBI Gene PubMed Count 7
Grant Count 8
Funding $1,255,702.5
PubMed Score 143.09
PubTator Score 20.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Gene RIF (4)

PMID Text
20972250 Observational study of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20160193 Observational study of gene-disease association. (HuGE Navigator)
19060906 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MAGSHPYFNLPDSTHPSPPSAPPSLRWHQRCQPSGATNGLLVALLGGGLPAGFVGPLSRMAYQGSNLPSL      1 - 70
ELLICRCLFHLPIALLLKLRGDPLLGPPDIRGWACFCALLNVLSIGCAYSAVQVVPAGNAATVRKGSSTV     71 - 140
CSAVLTLCLESQGLGGYEWCGLLGSILGLIIILGPGLWTLQEGTTGVYTTLGYVQAFLGGLALSLGLLVY    141 - 210
RSLHFPSCLPTVAFLSGLVGLLGCVPGLFVLQTPVLPSDLLSWSCVGAEGILALVSFTCVGYAVTKAHPA    211 - 280
LVCAVLHSEVVVALILQYYMLHETVALSDIMGAGVVLGSIAIITARNLSCERTGKVEE                281 - 338
//

Text Mined References (8)

PMID Year Title
20972250 2011 Genetic loci associated with lipid concentrations and cardiovascular risk factors in the Korean population.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20160193 2010 Investigation of variants identified in caucasian genome-wide association studies for plasma high-density lipoprotein cholesterol and triglycerides levels in Mexican dyslipidemic study samples.
19060906 2009 Common variants at 30 loci contribute to polygenic dyslipidemia.
17101974 2006 Emergence of primate genes by retrotransposon-mediated sequence transduction.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11896452 2002 Physical and transcriptional map of the critical region for keratolytic winter erythema (KWE) on chromosome 8p22-p23 between D8S550 and D8S1759.