Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Synonym

Accession Q96KT6
Symbols VIR35
C8orf14
NCRNA00208

Gene

 Compartment GO Term (0)

AA Sequence

MGQSLQEGRKQGRLLPAPSAHFLKHAHLASPSEVGGEPEIGSLCASHVLHMSPLYSVNLQVSPGSLTFHS      1 - 70
LSLRSTSTRLQPQSTYIVGPLC                                                     71 - 92
//

Text Mined References (2)

PMID Year Title
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
11896452 2002 Physical and transcriptional map of the critical region for keratolytic winter erythema (KWE) on chromosome 8p22-p23 between D8S550 and D8S1759.