Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Synonym

Accession Q96KT0
Symbols C8orf12

 Compartment GO Term (1)

AA Sequence

MGRSPCFFKSFKGKLHKDRSPDPSTLASPHPSTEARRPVEAGSAEWTWGWMKRLPPASLSPGIAMSCYSG      1 - 70
DSMLQKYKVKNAYRLHWQGREEPGASTFASLVFQ                                         71 - 104
//

Text Mined References (4)

PMID Year Title