Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.82779811579744E-13
gastric carcinoma 832 0.0157385461039098
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0353825278253016
Disease Target Count Z-score Confidence
systemic lupus erythematosus 172 0.0 2.0

Synonym

Accession Q96KT0
Symbols C8orf12

 Compartment GO Term (1)

AA Sequence

MGRSPCFFKSFKGKLHKDRSPDPSTLASPHPSTEARRPVEAGSAEWTWGWMKRLPPASLSPGIAMSCYSG      1 - 70
DSMLQKYKVKNAYRLHWQGREEPGASTFASLVFQ                                         71 - 104
//

Text Mined References (4)

PMID Year Title
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
16421571 2006 DNA sequence and analysis of human chromosome 8.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11896452 2002 Physical and transcriptional map of the critical region for keratolytic winter erythema (KWE) on chromosome 8p22-p23 between D8S550 and D8S1759.