Property Summary

NCBI Gene PubMed Count 21
PubMed Score 12.83
PubTator Score 11.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Astrocytoma, Pilocytic -1.200 9.9e-05
atypical teratoid / rhabdoid tumor -1.200 1.7e-04
cystic fibrosis 2.838 3.8e-06
ependymoma 1.600 2.1e-03
group 3 medulloblastoma -1.200 1.2e-02
interstitial lung disease -1.700 3.9e-02
intraductal papillary-mucinous adenoma (... 1.700 1.0e-02
intraductal papillary-mucinous carcinoma... 1.700 4.1e-02
lung adenocarcinoma -1.100 6.0e-17
medulloblastoma, large-cell -1.800 8.9e-05
non-small cell lung cancer -1.951 2.3e-16
oligodendroglioma 1.500 1.7e-03
pituitary cancer -1.700 9.2e-05
subependymal giant cell astrocytoma -1.324 4.7e-02
tuberculosis -1.500 2.4e-06

Gene RIF (19)

AA Sequence

MSVPQIHVEEVGAEEGAGAAAPPDDHLRSLKALTEKLRLETRRPSYLEWQARLEEHTWPFPRPAAEPQAS      1 - 70
LEEGERGGQEPLLPLREAGQHPPSARSASQGARPLSTGKLEGFQSIDEAIAWLRKELTEMRLQDQQLARQ     71 - 140
LMRLRGDINKLKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTPLKLIGVTKMNINSRR    141 - 210
FSLC                                                                      211 - 214
//

Text Mined References (24)

PMID Year Title