Property Summary

NCBI Gene PubMed Count 74
Grant Count 67
R01 Count 43
Funding $4,538,943.13
PubMed Score 0.00
PubTator Score 66.91

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96KS0 A8K5S0 Q8WWY4 Q9BV14
Symbols EIT6
PHD1
HPH-1
HPH-3
HIFPH1
HIF-PH1

Gene

 GO Component (2)

Gene RIF (44)

PMID Text
26997627 siRNA-mediated knockdown of PHD1 inhibited glucose-stimulated insulin secretion in pancreatic Beta cells.
26644182 PHD1 is phosphorylated by CDK2, CDK4 and CDK6 at Serine 130.
26492917 EglN2 associates with the NRF1-PGC1alpha complex and controls mitochondrial function in breast cancer
25609945 rs3733829 in the EGLN2 gene is significantly associated with the risk of COPD in Chinese populations of Hainan province.
25263965 Germ-line PHD1 and PHD2 mutations detected in patients with pheochromocytoma/paraganglioma-polycythemia
24935227 PHD1 could induce cell cycle arrest in lung cancer cells, resulting in the suppression of cell proliferation.
24894671 Data indicate that the prolyl hydrolase 1 (PHD1) rs10680577 polymorphism is associated with the risk of non-small cell lung cancer in a Chinese population.
24644426 PHD-1 played an important role in hypoxic response pathway of trophoblast through modulating the level of HIF-2alpha.
24517638 study conducted to investigate the association between gastric cancer (GC) susceptibility with a 4-bp insertion/deletion polymorphism (rs10680577) in the proximal promoter of EGLN2; findings showed that the heterozygote and the homozygote 4-bp del/del confer a significantly increased risk of GC
24195777 The diminished expression of PHD1 and PHD2 and elevated level of FIH protein in cancerous tissue compared to histopathologically unchanged colonic mucosa was not associated with DNA methylation within the CpG islands of the PHD1, PHD2 and FIH genes.
More...

AA Sequence

MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATS      1 - 70
TTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQRLAAQGARPEAPKRKWAEDGGDAPSPSKRPWARQE     71 - 140
NQEAEREGGMSCSCSSGSGEASAGLMEEALPSAPERLALDYIVPCMRYYGICVKDSFLGAALGGRVLAEV    141 - 210
EALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRT    211 - 280
KAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIF    281 - 350
WSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT                 351 - 407
//

Text Mined References (79)

PMID Year Title
26997627 2016 Role of prolyl hydroxylase domain proteins in the regulation of insulin secretion.
26644182 2016 CDK-dependent phosphorylation of PHD1 on serine 130 alters its substrate preference in cells.
26492917 2015 EglN2 associates with the NRF1-PGC1? complex and controls mitochondrial function in breast cancer.
25609945 2015 EGLN2 and RNF150 genetic variants are associated with chronic obstructive pulmonary disease risk in the Chinese population.
25263965 2015 Germ-line PHD1 and PHD2 mutations detected in patients with pheochromocytoma/paraganglioma-polycythemia.
24935227 2014 Over-expression of prolyl hydroxylase-1 blocks NF-?B-mediated cyclin D1 expression and proliferation in lung carcinoma cells.
24894671 2014 Polymorphism in PHD1 gene and risk of non-small cell lung cancer in a Chinese population.
24644426 2014 Study on the expressions of PHD and HIF in placentas from normal pregnant women and patients with preeclampsia.
24517638 2014 An insertion/deletion polymorphism within the proximal promoter of EGLN2 is associated with susceptibility for gastric cancer in the Chinese population.
24195777 2013 Expression and DNA methylation levels of prolyl hydroxylases PHD1, PHD2, PHD3 and asparaginyl hydroxylase FIH in colorectal cancer.
More...