Property Summary

NCBI Gene PubMed Count 16
PubMed Score 7.75
PubTator Score 10.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
ependymoma -3.500 0.000
glioblastoma -3.400 0.001
medulloblastoma -3.000 0.000
atypical teratoid/rhabdoid tumor -5.200 0.000
medulloblastoma, large-cell -4.400 0.000
primitive neuroectodermal tumor -1.800 0.042
pancreatic cancer 1.400 0.004
pediatric high grade glioma -2.900 0.000
subependymal giant cell astrocytoma -3.198 0.038
lung adenocarcinoma -1.600 0.000
pituitary cancer -3.400 0.000
psoriasis -1.500 0.000

Synonym

Accession Q96KR7 B1AKX0 B1AN68 B1AN69 B2RB46 Q32P33 Q707P6 Q9H4T4
Symbols H17739
SCAPIN1
PPP1R123
SCAPININ
C20orf101

Gene

Gene RIF (9)

PMID Text
22135045 DNA methylation of phosphatase and actin regulator 3 is associated with colorectal cancer.
21487013 Because its expression is highest in relatively plastic regions of the adult brain (cortex, hippocampus), scapinin is a new regulator of neurite outgrowth and neuroplasticity in the brain.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19473719 E2F4, PHACTR3, PRAME family member and CDH12 most probably play important role in non-small-cell lung cancer geneses
19158953 scapinin enhances cell spreading and motility through direct interaction with actin and PP1 plays a regulatory role in scapinin-induced morphological changes
16974080 a highly conserved complex genomic organization with four different leader exons; Alternative splicing of exon 5 was found to be limited to human vs. mouse; expression seems to occur predominantly in the brain
12925532 scapinin is a putative regulatory subunit of PP1 and is involved in transformed or immature phenotypes of HL-60 cells

AA Sequence

MAASEDGSGCLVSRGRSQSDPSVLTDSSATSSADAGENPDEMDQTPPARPEYLVSGIRTPPVRRNSKLAT      1 - 70
LGRIFKPWKWRKKKNEKLKQTTSALEKKMAGRQGREELIKKGLLEMMEQDAESKTCNPDGGPRSVQSEPP     71 - 140
TPKSETLTSEDAQPGSPLATGTDQVSLDKPLSSAAHLDDAAKMPSASSGEEADAGSLLPTTNELSQALAG    141 - 210
ADSLDSPPRPLERSVGQLPSPPLLPTPPPKASSKTTKNVTGQATLFQASSMKSADPSLRGQLSTPTGSPH    211 - 280
LTTVHRPLPPSRVIEELHRALATKHRQDSFQGRESKGSPKKRLDVRLSRTSSVERGKEREEAWSFDGALE    281 - 350
NKRTAAKESEENKENLIINSELKDDLLLYQDEEALNDSIISGTLPRKCKKELLAVKLRNRPSKQELEDRN    351 - 420
IFPRRTDEERQEIRQQIEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKLNQRPTVD    421 - 490
ELRDRKILIRFSDYVEVAKAQDYDRRADKPWTRLSAADKAAIRKELNEYKSNEMEVHASSKHLTRFHRP     491 - 559
//

Text Mined References (17)

PMID Year Title
22491018 2013 Genome-wide association analysis implicates the involvement of eight loci with response to tocilizumab for the treatment of rheumatoid arthritis.
22135045 2012 DNA methylation of phosphatase and actin regulator 3 detects colorectal cancer in stool and complements FIT.
21487013 2011 Scapinin-induced inhibition of axon elongation is attenuated by phosphorylation and translocation to the cytoplasm.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19473719 2010 Identification of genes associated with non-small-cell lung cancer promotion and progression.
19158953 2009 Scapinin, the protein phosphatase 1 binding protein, enhances cell spreading and motility by interacting with the actin cytoskeleton.
17693683 2007 Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction.
16974080 2006 Genomic organization and expression pattern of scapinin (PHACTR3) in mouse and human.
More...