Property Summary

NCBI Gene PubMed Count 4
Grant Count 34
R01 Count 19
Funding $3,394,867.88
PubMed Score 239.90
PubTator Score 152.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Gene RIF (2)

PMID Text
19706689 Immunofluorescent detection of human invadolysin in cultured cells reveals the protein to be associated with the surface of lipid droplets.
15557119 Functional characterization of a similar protein in Drosophila and comparative studies with the human protein.

AA Sequence

MVTTLGPKMAAEWGGGVGYSGSGPGRSRWRWSGSVWVRSVLLLLGGLRASATSTPVSLGSSPPCRHHVPS      1 - 70
DTEVINKVHLKANHVVKRDVDEHLRIKTVYDKSVEELLPEKKNLVKNKLFPQAISYLEKTFQVRRPAGTI     71 - 140
LLSRQCATNQYLRKENDPHRYCTGECAAHTKCGPVIVPEEHLQQCRVYRGGKWPHGAVGVPDQEGISDAD    141 - 210
FVLYVGALATERCSHENIISYAAYCQQEANMDRPIAGYANLCPNMISTQPQEFVGMLSTVKHEVIHALGF    211 - 280
SAGLFAFYHDKDGNPLTSRFADGLPPFNYSLGLYQWSDKVVRKVERLWDVRDNKIVRHTVYLLVTPRVVE    281 - 350
EARKHFDCPVLEGMELENQGGVGTELNHWEKRLLENEAMTGSHTQNRVLSRITLALMEDTGRQMLSPYCD    351 - 420
TLRSNPLQLTCRQDQRAVAVCNLQKFPKPLPQEYQYFDELSGIPAEDLPYYGGSVEIADYCPFSQEFSWH    421 - 490
LSGEYQRSSDCRILENQPEIFKNYGAEKYGPHSVCLIQKSAFVMEKCERKLSYPDWGSGCYQVSCSPQGL    491 - 560
KVWVQDTSYLCSRAGQVLPVSIQMNGWIHDGNLLCPSCWDFCELCPPETDPPATNLTRALPLDLCSCSSS    561 - 630
LVVTLWLLLGNLFPLLAGFLLCIWH                                                 631 - 655
//

Text Mined References (5)

PMID Year Title
19706689 2009 The conserved metalloprotease invadolysin localizes to the surface of lipid droplets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15557119 2004 Invadolysin: a novel, conserved metalloprotease links mitotic structural rearrangements with cell migration.