Property Summary

NCBI Gene PubMed Count 4
PubMed Score 133.12
PubTator Score 152.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 2.200 4.3e-02
medulloblastoma -1.300 5.2e-05
medulloblastoma, large-cell -1.100 5.3e-03
osteosarcoma 1.263 4.2e-04
pancreatic ductal adenocarcinoma liver m... 1.273 7.9e-04

Gene RIF (2)

AA Sequence

MVTTLGPKMAAEWGGGVGYSGSGPGRSRWRWSGSVWVRSVLLLLGGLRASATSTPVSLGSSPPCRHHVPS      1 - 70
DTEVINKVHLKANHVVKRDVDEHLRIKTVYDKSVEELLPEKKNLVKNKLFPQAISYLEKTFQVRRPAGTI     71 - 140
LLSRQCATNQYLRKENDPHRYCTGECAAHTKCGPVIVPEEHLQQCRVYRGGKWPHGAVGVPDQEGISDAD    141 - 210
FVLYVGALATERCSHENIISYAAYCQQEANMDRPIAGYANLCPNMISTQPQEFVGMLSTVKHEVIHALGF    211 - 280
SAGLFAFYHDKDGNPLTSRFADGLPPFNYSLGLYQWSDKVVRKVERLWDVRDNKIVRHTVYLLVTPRVVE    281 - 350
EARKHFDCPVLEGMELENQGGVGTELNHWEKRLLENEAMTGSHTQNRVLSRITLALMEDTGRQMLSPYCD    351 - 420
TLRSNPLQLTCRQDQRAVAVCNLQKFPKPLPQEYQYFDELSGIPAEDLPYYGGSVEIADYCPFSQEFSWH    421 - 490
LSGEYQRSSDCRILENQPEIFKNYGAEKYGPHSVCLIQKSAFVMEKCERKLSYPDWGSGCYQVSCSPQGL    491 - 560
KVWVQDTSYLCSRAGQVLPVSIQMNGWIHDGNLLCPSCWDFCELCPPETDPPATNLTRALPLDLCSCSSS    561 - 630
LVVTLWLLLGNLFPLLAGFLLCIWH                                                 631 - 655
//

Text Mined References (5)

PMID Year Title