Property Summary

NCBI Gene PubMed Count 12
PubMed Score 49.68
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Cri-Du-Chat syndrome 16 3.58 1.8

Expression

  Differential Expression (11)

Disease log2 FC p
Breast cancer 1.900 4.2e-02
Down syndrome 1.100 4.4e-03
ependymoma 1.100 5.6e-03
intraductal papillary-mucinous adenoma (... 1.200 1.6e-03
lung adenocarcinoma 1.094 3.3e-07
lung cancer 1.300 5.1e-03
Multiple myeloma 1.249 6.8e-03
oligodendroglioma 1.400 2.2e-03
osteosarcoma 1.676 1.7e-05
ovarian cancer -1.400 1.1e-05
Rheumatoid arthritis 1.100 1.8e-02

Gene RIF (3)

AA Sequence

MIPICPVVSFTYVPSRLGEDAKMATGNYFGFTHSGAAAAAAAAQYSQQPASGVAYSHPTTVASYTVHQAP      1 - 70
VAAHTVTAAYAPAAATVAVARPAPVAVAAAATAAAYGGYPTAHTATDYGYTQRQQEAPPPPPPATTQNYQ     71 - 140
DSYSYVRSTAPAVAYDSKQYYQQPTATAAAVAAAAQPQPSVAETYYQTAPKAGYSQGATQYTQAQQTRQV    141 - 210
TAIKPATPSPATTTFSIYPVSSTVQPVAAAATVVPSYTQSATYSTTAVTYSGTSYSGYEAAVYSAASSYY    211 - 280
QQQQQQQKQAAAAAAAAAATAAWTGTTFTKKAPFQNKQLKPKQPPKPPQIHYCDVCKISCAGPQTYKEHL    281 - 350
EGQKHKKKEAALKASQNTSSSNSSTRGTQNQLRCELCDVSCTGADAYAAHIRGAKHQKVVKLHTKLGKPI    351 - 420
PSTEPNVVSQATSSTAVSASKPTASPSSIAANNCTVNTSSVATSSMKGLTTTGNSSLNSTSNTKVSAVPT    421 - 490
NMAAKKTSTPKINFVGGNKLQSTGNKAEDIKGTECVKSTPVTSAVQIPEVKQDTVSEPVTPASLAALQSD    491 - 560
VQPVGHDYVEEVRNDEGKVIRFHCKLCECSFNDPNAKEMHLKGRRHRLQYKKKVNPDLQVEVKPSIRARK    561 - 630
IQEEKMRKQMQKEEYWRRREEEERWRMEMRRYEEDMYWRRMEEEQHHWDDRRRMPDGGYPHGPPGPLGLL    631 - 700
GVRPGMPPQPQGPAPLRRPDSSDDRYVMTKHATIYPTEEELQAVQKIVSITERALKLVSDSLSEHEKNKN    701 - 770
KEGDDKKEGGKDRALKGVLRVGVLAKGLLLRGDRNVNLVLLCSEKPSKTLLSRIAENLPKQLAVISPEKY    771 - 840
DIKCAVSEAAIILNSCVEPKMQVTITLTSPIIREENMREGDVTSGMVKDPPDVLDRQKCLDALAALRHAK    841 - 910
WFQARANGLQSCVIIIRILRDLCQRVPTWSDFPSWAMELLVEKAISSASSPQSPGDALRRVFECISSGII    911 - 980
LKGSPGLLDPCEKDPFDTLATMTDQQREDITSSAQFALRLLAFRQIHKVLGMDPLPQMSQRFNIHNNRKR    981 - 1050
RRDSDGVDGFEAEGKKDKKDYDNF                                                 1051 - 1074
//

Text Mined References (25)

PMID Year Title