Property Summary

NCBI Gene PubMed Count 12
Grant Count 3
Funding $217,713.7
PubMed Score 46.44
PubTator Score 1.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Rheumatoid Arthritis 1.100 0.018
Multiple myeloma 1.249 0.007
ependymoma 1.100 0.006
oligodendroglioma 1.400 0.002
osteosarcoma 2.689 0.000
intraductal papillary-mucinous adenoma (... 1.200 0.002
lung cancer 1.300 0.005
Breast cancer 1.900 0.042
lung adenocarcinoma 1.094 0.000
ovarian cancer -1.400 0.000
Down syndrome 1.100 0.004

Gene RIF (6)

PMID Text
25799583 polyadenylation allows differential negative feedback of human miRNA miR-579 on its host gene ZFR
25010285 Tandem affinity purification and mass spectrometry analysis identify zinc finger RNA binding protein (ZFR), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify zinc finger RNA binding protein (ZFR), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify zinc finger RNA binding protein (ZFR), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify zinc finger RNA binding protein (ZFR), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify zinc finger RNA binding protein (ZFR), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells

AA Sequence

MIPICPVVSFTYVPSRLGEDAKMATGNYFGFTHSGAAAAAAAAQYSQQPASGVAYSHPTTVASYTVHQAP      1 - 70
VAAHTVTAAYAPAAATVAVARPAPVAVAAAATAAAYGGYPTAHTATDYGYTQRQQEAPPPPPPATTQNYQ     71 - 140
DSYSYVRSTAPAVAYDSKQYYQQPTATAAAVAAAAQPQPSVAETYYQTAPKAGYSQGATQYTQAQQTRQV    141 - 210
TAIKPATPSPATTTFSIYPVSSTVQPVAAAATVVPSYTQSATYSTTAVTYSGTSYSGYEAAVYSAASSYY    211 - 280
QQQQQQQKQAAAAAAAAAATAAWTGTTFTKKAPFQNKQLKPKQPPKPPQIHYCDVCKISCAGPQTYKEHL    281 - 350
EGQKHKKKEAALKASQNTSSSNSSTRGTQNQLRCELCDVSCTGADAYAAHIRGAKHQKVVKLHTKLGKPI    351 - 420
PSTEPNVVSQATSSTAVSASKPTASPSSIAANNCTVNTSSVATSSMKGLTTTGNSSLNSTSNTKVSAVPT    421 - 490
NMAAKKTSTPKINFVGGNKLQSTGNKAEDIKGTECVKSTPVTSAVQIPEVKQDTVSEPVTPASLAALQSD    491 - 560
VQPVGHDYVEEVRNDEGKVIRFHCKLCECSFNDPNAKEMHLKGRRHRLQYKKKVNPDLQVEVKPSIRARK    561 - 630
IQEEKMRKQMQKEEYWRRREEEERWRMEMRRYEEDMYWRRMEEEQHHWDDRRRMPDGGYPHGPPGPLGLL    631 - 700
GVRPGMPPQPQGPAPLRRPDSSDDRYVMTKHATIYPTEEELQAVQKIVSITERALKLVSDSLSEHEKNKN    701 - 770
KEGDDKKEGGKDRALKGVLRVGVLAKGLLLRGDRNVNLVLLCSEKPSKTLLSRIAENLPKQLAVISPEKY    771 - 840
DIKCAVSEAAIILNSCVEPKMQVTITLTSPIIREENMREGDVTSGMVKDPPDVLDRQKCLDALAALRHAK    841 - 910
WFQARANGLQSCVIIIRILRDLCQRVPTWSDFPSWAMELLVEKAISSASSPQSPGDALRRVFECISSGII    911 - 980
LKGSPGLLDPCEKDPFDTLATMTDQQREDITSSAQFALRLLAFRQIHKVLGMDPLPQMSQRFNIHNNRKR    981 - 1050
RRDSDGVDGFEAEGKKDKKDYDNF                                                 1051 - 1074
//

Text Mined References (24)

PMID Year Title
27177590 2016 Knockdown of ZFR suppresses cell proliferation and invasion of human pancreatic cancer.
25799583 2015 Alternative polyadenylation allows differential negative feedback of human miRNA miR-579 on its host gene ZFR.
24482476 2014 Exome sequencing links corticospinal motor neuron disease to common neurodegenerative disorders.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...