Property Summary

NCBI Gene PubMed Count 12
PubMed Score 46.44
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung adenocarcinoma 2714 3.33361047052408E-7
osteosarcoma 7933 4.62248845029304E-7
ovarian cancer 8492 1.05619275065471E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00161392838582568
oligodendroglioma 2849 0.00222016588853434
Down syndrome 548 0.00437712267429045
lung cancer 4473 0.00512927069942269
ependymoma 2514 0.00562094989663521
Multiple myeloma 1328 0.00680272573198153
Rheumatoid Arthritis 1171 0.0176066030717534
Breast cancer 3099 0.042476040417104
Disease Target Count Z-score Confidence
Cri-Du-Chat syndrome 16 3.697 1.8

Expression

  Differential Expression (11)

Disease log2 FC p
Rheumatoid Arthritis 1.100 0.018
Multiple myeloma 1.249 0.007
ependymoma 1.100 0.006
oligodendroglioma 1.400 0.002
osteosarcoma 2.689 0.000
intraductal papillary-mucinous adenoma (... 1.200 0.002
lung cancer 1.300 0.005
Breast cancer 1.900 0.042
lung adenocarcinoma 1.094 0.000
ovarian cancer -1.400 0.000
Down syndrome 1.100 0.004

Synonym

Accession Q96KR1 B2RNR5 Q05C08 Q3B7X5 Q6P5A3 Q86UA0 Q9H6V4 Q9NTI1 Q9Y687 hZFR
Symbols ZFR1
SPG71

Gene

ZFR

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
25799583 polyadenylation allows differential negative feedback of human miRNA miR-579 on its host gene ZFR
25010285 Tandem affinity purification and mass spectrometry analysis identify zinc finger RNA binding protein (ZFR), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify zinc finger RNA binding protein (ZFR), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells

AA Sequence

MIPICPVVSFTYVPSRLGEDAKMATGNYFGFTHSGAAAAAAAAQYSQQPASGVAYSHPTTVASYTVHQAP      1 - 70
VAAHTVTAAYAPAAATVAVARPAPVAVAAAATAAAYGGYPTAHTATDYGYTQRQQEAPPPPPPATTQNYQ     71 - 140
DSYSYVRSTAPAVAYDSKQYYQQPTATAAAVAAAAQPQPSVAETYYQTAPKAGYSQGATQYTQAQQTRQV    141 - 210
TAIKPATPSPATTTFSIYPVSSTVQPVAAAATVVPSYTQSATYSTTAVTYSGTSYSGYEAAVYSAASSYY    211 - 280
QQQQQQQKQAAAAAAAAAATAAWTGTTFTKKAPFQNKQLKPKQPPKPPQIHYCDVCKISCAGPQTYKEHL    281 - 350
EGQKHKKKEAALKASQNTSSSNSSTRGTQNQLRCELCDVSCTGADAYAAHIRGAKHQKVVKLHTKLGKPI    351 - 420
PSTEPNVVSQATSSTAVSASKPTASPSSIAANNCTVNTSSVATSSMKGLTTTGNSSLNSTSNTKVSAVPT    421 - 490
NMAAKKTSTPKINFVGGNKLQSTGNKAEDIKGTECVKSTPVTSAVQIPEVKQDTVSEPVTPASLAALQSD    491 - 560
VQPVGHDYVEEVRNDEGKVIRFHCKLCECSFNDPNAKEMHLKGRRHRLQYKKKVNPDLQVEVKPSIRARK    561 - 630
IQEEKMRKQMQKEEYWRRREEEERWRMEMRRYEEDMYWRRMEEEQHHWDDRRRMPDGGYPHGPPGPLGLL    631 - 700
GVRPGMPPQPQGPAPLRRPDSSDDRYVMTKHATIYPTEEELQAVQKIVSITERALKLVSDSLSEHEKNKN    701 - 770
KEGDDKKEGGKDRALKGVLRVGVLAKGLLLRGDRNVNLVLLCSEKPSKTLLSRIAENLPKQLAVISPEKY    771 - 840
DIKCAVSEAAIILNSCVEPKMQVTITLTSPIIREENMREGDVTSGMVKDPPDVLDRQKCLDALAALRHAK    841 - 910
WFQARANGLQSCVIIIRILRDLCQRVPTWSDFPSWAMELLVEKAISSASSPQSPGDALRRVFECISSGII    911 - 980
LKGSPGLLDPCEKDPFDTLATMTDQQREDITSSAQFALRLLAFRQIHKVLGMDPLPQMSQRFNIHNNRKR    981 - 1050
RRDSDGVDGFEAEGKKDKKDYDNF                                                 1051 - 1074
//

Text Mined References (24)

PMID Year Title
27177590 2016 Knockdown of ZFR suppresses cell proliferation and invasion of human pancreatic cancer.
25799583 2015 Alternative polyadenylation allows differential negative feedback of human miRNA miR-579 on its host gene ZFR.
24482476 2014 Exome sequencing links corticospinal motor neuron disease to common neurodegenerative disorders.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...