Property Summary

NCBI Gene PubMed Count 106
Grant Count 117
R01 Count 69
Funding $13,170,963.02
PubMed Score 285.47
PubTator Score 129.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.677 0.000
lung cancer 1.700 0.000
ovarian cancer 1.600 0.000

Synonym

Accession Q96KQ7 B0UZY2 Q14349 Q5JP83 Q5JQ92 Q5JQA1 Q5JQG3 Q6PK06 Q96MH5 Q96QD0 Q9UQL8 Q9Y331
Symbols G9A
BAT8
GAT8
NG36
KMT1C
C6orf30

Gene

PDB

5JHN   5JIN   5JJ0   2O8J   3DM1   3K5K   3RJW   4NVQ   5JIY  

Gene RIF (73)

PMID Text
26960573 Along with the PHF20/MOF complex, G9a links the crosstalk between ERalpha methylation and histone acetylation that governs the epigenetic regulation of hormonal gene expression.
26765460 high expression in hepatocellular carcinoma associated with worse outcome
26551542 G9a has a dominant function in transcriptional repression of potassium channels and in acute-to-chronic pain transition.
26397365 The present study aimed at examining the potential role of autophagy in the anti-proliferation effect of G9a inhibition on transitional cell carcinoma T24 and UMUC-3 cell lines in vitro.
26320100 data provide genetic and pharmacologic evidence that EHMT1 and EHMT2 are epigenetic regulators involved in gamma-globin repression and represent a novel therapeutic target for SCD.
26192994 Homocysteine Induces Collagen I Expression by Downregulating Histone Methyltransferase G9a
25982273 LASP-1 associated with UHRF1, G9a, Snail1 and di- and tri-methylated histoneH3 in a CXCL12-dependent manner based on immunoprecipitation and proximity ligation assays
25935252 This study demonstrate that the increases in a restrictive epigenome seen in schizophrenia are sex dependent. Specifically,G9A were significantly increased in lymphocytes from men with schizophrenia.
25843229 KMT1c (G9a) is markedly up regulated after differentiation of monocytes into immature dendritic cells.
25840984 we defined a role for activated STAT3 and G9a histone methyltransferase in epigenetic silencing of miR-200c, which promotes the formation of breast CSCs defined by elevated cell surface levels of the leptin receptor
25789554 Data indicate zinc finger proteins ZNF644 and WIZ as two core subunits in the histone-lysine N-methyltransferase G9a/GLP complex, and interact with the transcription activation domain of G9a and GLP.
25749385 G9a protein is essential for the induction of epithelial-to-mesenchymal transition and cancer stem cell-like properties in HNSCC
25634693 H3K9 methyltransferase G9a plays role in the apoptosis and autophagy in oral squamous cell carcinoma.
25613390 High G9a contributes to endometrial cancer progression.
25595900 Down-regulation of G9a triggers DNA damage response and inhibits colorectal cancer cells proliferation.
25365549 The current knowledge on the mechanisms of action and function of EHMT2, with particular emphasis on their interplay in the regulation of chromatin states and biological processes.
25115793 G9a contributes to multiple steps of ovarian cancer metastasis.
25079219 The expression level of EHMT1 and EHMT2 inversely correlates with the type I interferon responsiveness in chronic myeloid leukemia cell lines.
25071150 Results show that G9a acts positively to promote tumor formation.
25027955 Genetic or pharmacological inhibition of G9a reduced cell proliferation without inducing necrosis or apoptosis.
24833465 G9a-dependent H3K9me2 repression on CD133 and Sox2 was one of the main switches of the self-renewal in glioma cancer stem cells.
24805087 MCM7 and G9a may serve as effective prognostic factors and could also be used as biomarkers for predicting various clinical outcomes of oesophageal squamous cell carcinoma
24658378 overexpression of EHMT2 might be a prognostic marker in patients with melanoma.
24652950 G9a- and EZH2-mediated histone hypermethylation.
24492005 G9a functions as a coactivator for p21 transcription, and directs cells to undergo apoptosis.
24389103 PRC2 and G9a/GLP interact physically and functionally.
24315373 G9A inactivation depletes serine and its downstream metabolites, triggering cell death with autophagy in cancer cell lines of different tissue origins.
24019522 all of the H3K36-specific methyltransferases, including ASH1L, HYPB, NSD1, and NSD2 were inhibited by ubH2A, whereas the other histone methyltransferases, including PRC2, G9a, and Pr-Set7 were not affected by ubH2A.
23918802 G9a directly represses genes known to participate in the autophagic process.
23807219 G9a inhibition may help overcome drug resistance in certain cancer cells.
23760081 Genome association studies identified EHMT2 as a new risk-associated loci for chronic hepatitis B on the HLA region of chromosome 6.
23637228 Sumoylation of Sharp-1 exerts an impact on chromatin structure and transcriptional repression of muscle gene expression through recruitment of G9a.
23629948 These findings suggest that h-CDYLb and G9a are cooperatively involved in hepatocellular carcinomas
23481705 H3K9me3-positive grade II oligodendrogliomas, but not other tumor subtypes, show improved overall survival compared with H3K9me3-negative cases.
23466651 Histone-lysine methyltransferase EHMT2 is involved in proliferation, apoptosis, cell invasion, and DNA methylation of human neuroblastoma cells.
23283977 G9a mediates E4BP4-dependent suppression of hepatic Fgf21 by enhancing histone methylation (H3K9me2) of the Fgf21 promoter
23244065 With G9a and GLP1 as representative Protein methyltransferases (PMTs), it demonstrated the use of methionine analogues, a MAT variant and engineered PMTs for substrate labeling in vitro and genome-wide chromatin modifications within living cells.
23151507 findings indicate distinct mechanisms of G9a coactivator vs. corepressor functions in transcriptional regulation and provide insight into the molecular mechanisms of G9a coactivator function
22801367 data show that HMTase G9a negatively regulates JAK2 transcription and H3Y41 phosphorylation on the lmo2 promoter; and study provides new insights into G9a function in the regulation of hematopoiesis and leukemogenesis
22406531 Snail interacted with G9a, a major euchromatin methyltransferase responsible for H3K9me2, and recruited G9a and DNA methyltransferases to the E-cadherin promoter for DNA methylation.
22389001 study concludes that a subset of cancer-related Runx2 target genes require recruitment of G9a for their expression, but do not depend on its histone methyltransferase activity
21984853 the coactivator and corepressor functions of G9a involve different G9a domains and different molecular mechanisms
21847359 Our results suggest that dysregulation of EHMT2 plays an important role in the growth regulation of cancer cells.
21041608 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20960050 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20940408 Findings establish a functional contributio of G9a overexpression with concomitant dysregulation of epigenetic pathways in lung cancer progression.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20421388 Genome-wide analysis and microarray can identify genes that are specifical regulated by G9a.
20335163 G9a is responsible for the transcriptional quiescence of latent HIV-1 provirus
20335163 Histone H3 Lysine9 (H3K9) methyltransferase G9a significantly inhibits basal and the TNF-alpha- or HIV-1 Tat- induced HIV-1 gene expression for the maintenance of HIV-1 latency
20118233 G9a and Glp methylate lysine 373 in the tumor suppressor p53
19851445 Observational study of gene-disease association. (HuGE Navigator)
19843671 EHMT2 polymorphisms are associated with colorectal cancer.
19843671 Observational study of gene-disease association. (HuGE Navigator)
19776757 EVI-1 interacts with histone methyltransferases SUV39H1 and G9a for transcriptional repression and bone marrow immortalization.
19690169 Data show that RelB induces facultative heterochromatin formation by directly interacting with the histone H3 lysine 9 methyltransferase G9a.
19531572 We found robust DNA hypomethylation in G9a/GLP knockdown of murine ES cells but a lack of DNA methylation changes in G9a/GLP knockdown human cancer cells; intriguingly, this distinction also extended to markers of global DNA methylation.
19144645 Dynamic Histone H1 Isotype 4 Methylation and Demethylation by Histone Lysine Methyltransferase G9a/KMT1C and the Jumonji Domain-containing JMJD2/KDM4 Proteins
19124506 Observational study of gene-disease association. (HuGE Navigator)
19061646 Chromodomain on Y-like (CDYL) is identified as a REST corepressor that physically bridges REST and the histone methylase G9a to repress transcription.
18850007 Hypoxia upregulates G9a histone methyltransferase & HDAC1. Overexpression of G9a & HDAC1 attenuated RUNX3 expression. The overexpression of G9a & HDAC1, but not their mutants, inhibited the nuclear localization & expression of RUNX3.
18809684 G9a and HP1 couple histone and DNA methylation to TNFalpha transcription silencing during endotoxin tolerance
18647749 /EBPbeta as a direct substrate of G9a-mediated post-translational modification that alters the functional properties of C/EBPbeta during gene regulation.
18446223 These data suggest that the 2 HMTs, SUV39H1 and G9a are required to perpetuate the malignant phenotype.
17707230 The results reveal the mechanism underlying CSB-mediated activation of ribosomal DNA transcription and link G9a-dependent histone methylation to Pol I transcription elongation through chromatin.
17584299 ZNF200 is a novel binding partner of G9a.
17145766 These studies establish a critical role for G9a methyltransferase, histone deacetylases, and the Swi/Snf-Brm complex in the SHP-mediated inhibition of hepatic bile acid synthesis via coordinated chromatin modification at target genes.
17085482 Direct cooperation between DNMT1 and G9a provides a mechanism of coordinated DNA and H3K9 methylation during cell division.
17005678 results show human cytomegalovirus IE86 interacts with HDAC1 and histone methyltransferases G9a and Suvar(3-9)H1 and that coexpression of these chromatin remodeling enzymes with IE86 increases autorepression of the major immediate-early promoter
16501248 Observational study of gene-disease association. (HuGE Navigator)
16287849 Gfi1 associates with G9a and HDAC1 on the promoter of the cell cycle regulator p21Cip/WAF1, resulting in an increase in K9 dimethylation at histone H3
15590646 Phe at the position equivalent to Phe(281) of Neurospora crassa DIM-5 or Phe(1205) of human G9a allows the enzyme to perform di and tri-methylation, whereas a Tyr at this position is restrictive, inhibiting tri-methylation and yielding a mono- or di-MTase
15269344 interaction of G9a with a sequence-specific transcription factor that regulates gene repression through CDP/cut.

AA Sequence

MAAAAGAAAAAAAEGEAPAEMGALLLEKETRGATERVHGSLGDTPRSEETLPKATPDSLEPAGPSSPASV      1 - 70
TVTVGDEGADTPVGATPLIGDESENLEGDGDLRGGRILLGHATKSFPSSPSKGGSCPSRAKMSMTGAGKS     71 - 140
PPSVQSLAMRLLSMPGAQGAAAAGSEPPPATTSPEGQPKVHRARKTMSKPGNGQPPVPEKRPPEIQHFRM    141 - 210
SDDVHSLGKVTSDLAKRRKLNSGGGLSEELGSARRSGEVTLTKGDPGSLEEWETVVGDDFSLYYDSYSVD    211 - 280
ERVDSDSKSEVEALTEQLSEEEEEEEEEEEEEEEEEEEEEEEEDEESGNQSDRSGSSGRRKAKKKWRKDS    281 - 350
PWVKPSRKRRKREPPRAKEPRGVNGVGSSGPSEYMEVPLGSLELPSEGTLSPNHAGVSNDTSSLETERGF    351 - 420
EELPLCSCRMEAPKIDRISERAGHKCMATESVDGELSGCNAAILKRETMRPSSRVALMVLCETHRARMVK    421 - 490
HHCCPGCGYFCTAGTFLECHPDFRVAHRFHKACVSQLNGMVFCPHCGEDASEAQEVTIPRGDGVTPPAGT    491 - 560
AAPAPPPLSQDVPGRADTSQPSARMRGHGEPRRPPCDPLADTIDSSGPSLTLPNGGCLSAVGLPLGPGRE    561 - 630
ALEKALVIQESERRKKLRFHPRQLYLSVKQGELQKVILMLLDNLDPNFQSDQQSKRTPLHAAAQKGSVEI    631 - 700
CHVLLQAGANINAVDKQQRTPLMEAVVNNHLEVARYMVQRGGCVYSKEEDGSTCLHHAAKIGNLEMVSLL    701 - 770
LSTGQVDVNAQDSGGWTPIIWAAEHKHIEVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLLNA    771 - 840
RCDLHAVNYHGDTPLHIAARESYHDCVLLFLSRGANPELRNKEGDTAWDLTPERSDVWFALQLNRKLRLG    841 - 910
VGNRAIRTEKIICRDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETSTMNIDRNITHLQHCTCVDDC    911 - 980
SSSNCLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQACSCWRNCKNRVVQSGIKVRLQLYRTAKMGW    981 - 1050
GVRALQTIPQGTFICEYVGELISDAEADVREDDSYLFDLDNKDGEVYCIDARYYGNISRFINHLCDPNII   1051 - 1120
PVRVFMLHQDLRFPRIAFFSSRDIRTGEELGFDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIALEQSRLA   1121 - 1190
RLDPHPELLPELGSLPPVNT                                                     1191 - 1210
//

Text Mined References (116)

PMID Year Title
26960573 2016 G9a-mediated methylation of ER? links the PHF20/MOF histone acetyltransferase complex to hormonal gene expression.
26765460 2016 Association of Histone Methyltransferase G9a and Overall Survival After Liver Resection of Patients With Hepatocellular Carcinoma With a Median Observation of 40 Months.
26551542 2015 G9a is essential for epigenetic silencing of K(+) channel genes in acute-to-chronic pain transition.
26397365 2015 G9a Inhibition Induces Autophagic Cell Death via AMPK/mTOR Pathway in Bladder Transitional Cell Carcinoma.
26320100 2015 EHMT1 and EHMT2 inhibition induces fetal hemoglobin expression.
26192994 2015 Homocysteine Induces Collagen I Expression by Downregulating Histone Methyltransferase G9a.
26028330 2015 Dysfunction of the Reciprocal Feedback Loop between GATA3- and ZEB2-Nucleated Repression Programs Contributes to Breast Cancer Metastasis.
25982273 2016 LASP-1: a nuclear hub for the UHRF1-DNMT1-G9a-Snail1 complex.
25935252 2015 Evidence of a sex-dependent restrictive epigenome in schizophrenia.
25843229 2015 A role for KMT1c in monocyte to dendritic cell differentiation: Epigenetic regulation of monocyte differentiation.
25840984 2015 Leptin-STAT3-G9a Signaling Promotes Obesity-Mediated Breast Cancer Progression.
25789554 2015 The zinc finger proteins ZNF644 and WIZ regulate the G9a/GLP complex for gene repression.
25749385 2015 G9a is essential for EMT-mediated metastasis and maintenance of cancer stem cell-like characters in head and neck squamous cell carcinoma.
25634693 2015 Inhibition of H3K9 methyltransferase G9a induces autophagy and apoptosis in oral squamous cell carcinoma.
25613390 2015 The H3K9 Methyltransferase G9a Represses E-cadherin and is Associated with Myometrial Invasion in Endometrial Cancer.
25595900 2015 Down-regulation of G9a triggers DNA damage response and inhibits colorectal cancer cells proliferation.
25365549 2015 Functional Crosstalk Between Lysine Methyltransferases on Histone Substrates: The Case of G9A/GLP and Polycomb Repressive Complex 2.
25115793 2014 The H3K9 methyltransferase G9a is a marker of aggressive ovarian cancer that promotes peritoneal metastasis.
25079219 2014 Inhibition of euchromatic histone methyltransferase 1 and 2 sensitizes chronic myeloid leukemia cells to interferon treatment.
25071150 2014 The hypoxia-inducible epigenetic regulators Jmjd1a and G9a provide a mechanistic link between angiogenesis and tumor growth.
25027955 2014 Inhibition of G9a induces DUSP4-dependent autophagic cell death in head and neck squamous cell carcinoma.
24833465 2014 Histone methyltransferase G9a and H3K9 dimethylation inhibit the self-renewal of glioma cancer stem cells.
24805087 2015 Overexpression of G9a and MCM7 in oesophageal squamous cell carcinoma is associated with poor prognosis.
24658378 2014 Immunohistochemistry for histone h3 lysine 9 methyltransferase and demethylase proteins in human melanomas.
24652950 2014 A central role for G9a and EZH2 in the epigenetic silencing of cyclooxygenase-2 in idiopathic pulmonary fibrosis.
24492005 2014 H3K9 histone methyltransferase G9a-mediated transcriptional activation of p21.
24389103 2014 The histone H3 lysine 9 methyltransferases G9a and GLP regulate polycomb repressive complex 2-mediated gene silencing.
24322755 2013 BIX-01294 induces autophagy-associated cell death via EHMT2/G9a dysfunction and intracellular reactive oxygen species production.
24315373 2013 The histone H3 methyltransferase G9A epigenetically activates the serine-glycine synthesis pathway to sustain cancer cell survival and proliferation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24019522 2013 Histone H2A ubiquitination inhibits the enzymatic activity of H3 lysine 36 methyltransferases.
23918802 2013 Epigenetic regulation of autophagy by the methyltransferase G9a.
23807219 2013 Gossypol and an HMT G9a inhibitor act in synergy to induce cell death in pancreatic cancer cells.
23760081 2013 A genome-wide association study identified new variants associated with the risk of chronic hepatitis B.
23752268 2013 The functional interactome landscape of the human histone deacetylase family.
23637228 2013 Sumoylation of the basic helix-loop-helix transcription factor sharp-1 regulates recruitment of the histone methyltransferase G9a and function in myogenesis.
23629948 2013 Short-Form CDYLb but not long-form CDYLa functions cooperatively with histone methyltransferase G9a in hepatocellular carcinomas.
23481705 2013 Histone 3 lysine 9 trimethylation is differentially associated with isocitrate dehydrogenase mutations in oligodendrogliomas and high-grade astrocytomas.
23466651 2013 Histone-lysine methyltransferase EHMT2 is involved in proliferation, apoptosis, cell invasion, and DNA methylation of human neuroblastoma cells.
23326239 2013 A genome-wide integrative genomic study localizes genetic factors influencing antibodies against Epstein-Barr virus nuclear antigen 1 (EBNA-1).
23283977 2013 Recruitment of histone methyltransferase G9a mediates transcriptional repression of Fgf21 gene by E4BP4 protein.
23244065 2013 Profiling genome-wide chromatin methylation with engineered posttranslation apparatus within living cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23151507 2012 G9a functions as a molecular scaffold for assembly of transcriptional coactivators on a subset of glucocorticoid receptor target genes.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22801367 2012 Negative regulation of JAK2 by H3K9 methyltransferase G9a in leukemia.
22566634 2012 The genetic architecture of economic and political preferences.
22406531 2012 G9a interacts with Snail and is critical for Snail-mediated E-cadherin repression in human breast cancer.
22389001 2012 Recruitment of coregulator G9a by Runx2 for selective enhancement or suppression of transcription.
22387026 2012 Histone H3 lysine 56 methylation regulates DNA replication through its interaction with PCNA.
21984853 2011 A distinct mechanism for coactivator versus corepressor function by histone methyltransferase G9a in transcriptional regulation.
21847359 2011 Enhanced expression of EHMT2 is involved in the proliferation of cancer cells through negative regulation of SIAH1.
21549307 2011 Maintenance of silent chromatin through replication requires SWI/SNF-like chromatin remodeler SMARCAD1.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21323541 2011 Risk HLA-DQA1 and PLA(2)R1 alleles in idiopathic membranous nephropathy.
21041608 2011 Family-based analysis of genetic variation underlying psychosis-inducing effects of cannabis: sibling analysis and proband follow-up.
20960050 2011 Dietary methyl donors, methyl metabolizing enzymes, and epigenetic regulators: diet-gene interactions and promoter CpG island hypermethylation in colorectal cancer.
20940408 2010 H3K9 histone methyltransferase G9a promotes lung cancer invasion and metastasis by silencing the cell adhesion molecule Ep-CAM.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20421388 2010 Activating and inhibitory functions for the histone lysine methyltransferase G9a in T helper cell differentiation and function.
20335163 2010 Involvement of histone H3 lysine 9 (H3K9) methyltransferase G9a in the maintenance of HIV-1 latency and its reactivation by BIX01294.
20118233 2010 G9a and Glp methylate lysine 373 in the tumor suppressor p53.
20084102 2010 Structural biology of human H3K9 methyltransferases.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20056891 2010 Essential role of the histone methyltransferase G9a in cocaine-induced plasticity.
20005824 2009 Control of cognition and adaptive behavior by the GLP/G9a epigenetic suppressor complex.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19843671 2009 Genetic variants of methyl metabolizing enzymes and epigenetic regulators: associations with promoter CpG island hypermethylation in colorectal cancer.
19776757 2010 EVI-1 interacts with histone methyltransferases SUV39H1 and G9a for transcriptional repression and bone marrow immortalization.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19690169 2009 The NF-kappaB factor RelB and histone H3 lysine methyltransferase G9a directly interact to generate epigenetic silencing in endotoxin tolerance.
19531572 2009 Distinct roles for histone methyltransferases G9a and GLP in cancer germ-line antigen gene regulation in human cancer cells and murine embryonic stem cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19144645 2009 Dynamic Histone H1 Isotype 4 Methylation and Demethylation by Histone Lysine Methyltransferase G9a/KMT1C and the Jumonji Domain-containing JMJD2/KDM4 Proteins.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19061646 2008 CDYL bridges REST and histone methyltransferases for gene repression and suppression of cellular transformation.
19056828 2009 UHRF1 binds G9a and participates in p21 transcriptional regulation in mammalian cells.
18988810 2008 The Air noncoding RNA epigenetically silences transcription by targeting G9a to chromatin.
18850007 2009 Hypoxic silencing of tumor suppressor RUNX3 by histone modification in gastric cancer cells.
18809684 2008 G9a and HP1 couple histone and DNA methylation to TNFalpha transcription silencing during endotoxin tolerance.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18647749 2008 G9a-mediated lysine methylation alters the function of CCAAT/enhancer-binding protein-beta.
18451879 2008 Atrophin recruits HDAC1/2 and G9a to modify histone H3K9 and to determine cell fates.
18446223 2008 Downregulation of histone H3 lysine 9 methyltransferase G9a induces centrosome disruption and chromosome instability in cancer cells.
18438403 2008 Protein lysine methyltransferase G9a acts on non-histone targets.
18264113 2008 The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules.
17707231 2007 Methylation of a histone mimic within the histone methyltransferase G9a regulates protein complex assembly.
17707230 2007 Activation of RNA polymerase I transcription by cockayne syndrome group B protein and histone methyltransferase G9a.
17636019 2007 Epigenetic regulation of protein-coding and microRNA genes by the Gfi1-interacting tumor suppressor PRDM5.
17584299 2007 Identification of ZNF200 as a novel binding partner of histone H3 methyltransferase G9a.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17145766 2007 Coordinated recruitment of histone methyltransferase G9a and other chromatin-modifying enzymes in SHP-mediated regulation of hepatic bile acid metabolism.
17085482 2006 Direct interaction between DNMT1 and G9a coordinates DNA and histone methylation during replication.
17005678 2006 Autorepression of the human cytomegalovirus major immediate-early promoter/enhancer at late times of infection is mediated by the recruitment of chromatin remodeling enzymes by IE86.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16702210 2006 Zinc finger protein Wiz links G9a/GLP histone methyltransferases to the co-repressor molecule CtBP.
16688220 2006 Gfi1b alters histone methylation at target gene promoters and sites of gamma-satellite containing heterochromatin.
16501248 2006 Genetic variants in epigenetic genes and breast cancer risk.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16287849 2005 Gfi1 coordinates epigenetic repression of p21Cip/WAF1 by recruitment of histone lysine methyltransferase G9a and histone deacetylase 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15590646 2005 In vitro and in vivo analyses of a Phe/Tyr switch controlling product specificity of histone lysine methyltransferases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15269344 2004 CCAAT displacement protein/cut homolog recruits G9a histone lysine methyltransferase to repress transcription.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14656967 2003 Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12700765 2003 Coordinated histone modifications mediated by a CtBP co-repressor complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12130538 2002 G9a histone methyltransferase plays a dominant role in euchromatic histone H3 lysine 9 methylation and is essential for early embryogenesis.
12004135 2002 A complex with chromatin modifiers that occupies E2F- and Myc-responsive genes in G0 cells.
11707778 2001 Novel NG36/G9a gene products encoded within the human and mouse MHC class III regions.
11316813 2001 Set domain-containing protein, G9a, is a novel lysine-preferring mammalian histone methyltransferase with hyperactivity and specific selectivity to lysines 9 and 27 of histone H3.
8457211 1993 The G9a gene in the human major histocompatibility complex encodes a novel protein containing ankyrin-like repeats.
2813433 1989 Human major histocompatibility complex contains a minimum of 19 genes between the complement cluster and HLA-B.