Property Summary

NCBI Gene PubMed Count 106
Grant Count 117
R01 Count 69
Funding $13,170,963.02
PubMed Score 285.47
PubTator Score 129.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.677 0.000
lung cancer 1.700 0.000
ovarian cancer 1.600 0.000

Synonym

Accession Q96KQ7 B0UZY2 Q14349 Q5JP83 Q5JQ92 Q5JQA1 Q5JQG3 Q6PK06 Q96MH5 Q96QD0 Q9UQL8 Q9Y331
Symbols G9A
BAT8
GAT8
NG36
KMT1C
C6orf30

Gene

PDB

5JHN   5JIN   5JJ0   2O8J   3DM1   3K5K   3RJW   4NVQ   5JIY  

Gene RIF (73)

PMID Text
26960573 Along with the PHF20/MOF complex, G9a links the crosstalk between ERalpha methylation and histone acetylation that governs the epigenetic regulation of hormonal gene expression.
26765460 high expression in hepatocellular carcinoma associated with worse outcome
26551542 G9a has a dominant function in transcriptional repression of potassium channels and in acute-to-chronic pain transition.
26397365 The present study aimed at examining the potential role of autophagy in the anti-proliferation effect of G9a inhibition on transitional cell carcinoma T24 and UMUC-3 cell lines in vitro.
26320100 data provide genetic and pharmacologic evidence that EHMT1 and EHMT2 are epigenetic regulators involved in gamma-globin repression and represent a novel therapeutic target for SCD.
26192994 Homocysteine Induces Collagen I Expression by Downregulating Histone Methyltransferase G9a
25982273 LASP-1 associated with UHRF1, G9a, Snail1 and di- and tri-methylated histoneH3 in a CXCL12-dependent manner based on immunoprecipitation and proximity ligation assays
25935252 This study demonstrate that the increases in a restrictive epigenome seen in schizophrenia are sex dependent. Specifically,G9A were significantly increased in lymphocytes from men with schizophrenia.
25843229 KMT1c (G9a) is markedly up regulated after differentiation of monocytes into immature dendritic cells.
25840984 we defined a role for activated STAT3 and G9a histone methyltransferase in epigenetic silencing of miR-200c, which promotes the formation of breast CSCs defined by elevated cell surface levels of the leptin receptor
More...

AA Sequence

MAAAAGAAAAAAAEGEAPAEMGALLLEKETRGATERVHGSLGDTPRSEETLPKATPDSLEPAGPSSPASV      1 - 70
TVTVGDEGADTPVGATPLIGDESENLEGDGDLRGGRILLGHATKSFPSSPSKGGSCPSRAKMSMTGAGKS     71 - 140
PPSVQSLAMRLLSMPGAQGAAAAGSEPPPATTSPEGQPKVHRARKTMSKPGNGQPPVPEKRPPEIQHFRM    141 - 210
SDDVHSLGKVTSDLAKRRKLNSGGGLSEELGSARRSGEVTLTKGDPGSLEEWETVVGDDFSLYYDSYSVD    211 - 280
ERVDSDSKSEVEALTEQLSEEEEEEEEEEEEEEEEEEEEEEEEDEESGNQSDRSGSSGRRKAKKKWRKDS    281 - 350
PWVKPSRKRRKREPPRAKEPRGVNGVGSSGPSEYMEVPLGSLELPSEGTLSPNHAGVSNDTSSLETERGF    351 - 420
EELPLCSCRMEAPKIDRISERAGHKCMATESVDGELSGCNAAILKRETMRPSSRVALMVLCETHRARMVK    421 - 490
HHCCPGCGYFCTAGTFLECHPDFRVAHRFHKACVSQLNGMVFCPHCGEDASEAQEVTIPRGDGVTPPAGT    491 - 560
AAPAPPPLSQDVPGRADTSQPSARMRGHGEPRRPPCDPLADTIDSSGPSLTLPNGGCLSAVGLPLGPGRE    561 - 630
ALEKALVIQESERRKKLRFHPRQLYLSVKQGELQKVILMLLDNLDPNFQSDQQSKRTPLHAAAQKGSVEI    631 - 700
CHVLLQAGANINAVDKQQRTPLMEAVVNNHLEVARYMVQRGGCVYSKEEDGSTCLHHAAKIGNLEMVSLL    701 - 770
LSTGQVDVNAQDSGGWTPIIWAAEHKHIEVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLLNA    771 - 840
RCDLHAVNYHGDTPLHIAARESYHDCVLLFLSRGANPELRNKEGDTAWDLTPERSDVWFALQLNRKLRLG    841 - 910
VGNRAIRTEKIICRDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETSTMNIDRNITHLQHCTCVDDC    911 - 980
SSSNCLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQACSCWRNCKNRVVQSGIKVRLQLYRTAKMGW    981 - 1050
GVRALQTIPQGTFICEYVGELISDAEADVREDDSYLFDLDNKDGEVYCIDARYYGNISRFINHLCDPNII   1051 - 1120
PVRVFMLHQDLRFPRIAFFSSRDIRTGEELGFDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIALEQSRLA   1121 - 1190
RLDPHPELLPELGSLPPVNT                                                     1191 - 1210
//

Text Mined References (116)

PMID Year Title
26960573 2016 G9a-mediated methylation of ER? links the PHF20/MOF histone acetyltransferase complex to hormonal gene expression.
26765460 2016 Association of Histone Methyltransferase G9a and Overall Survival After Liver Resection of Patients With Hepatocellular Carcinoma With a Median Observation of 40 Months.
26551542 2015 G9a is essential for epigenetic silencing of K(+) channel genes in acute-to-chronic pain transition.
26397365 2015 G9a Inhibition Induces Autophagic Cell Death via AMPK/mTOR Pathway in Bladder Transitional Cell Carcinoma.
26320100 2015 EHMT1 and EHMT2 inhibition induces fetal hemoglobin expression.
26192994 2015 Homocysteine Induces Collagen I Expression by Downregulating Histone Methyltransferase G9a.
26028330 2015 Dysfunction of the Reciprocal Feedback Loop between GATA3- and ZEB2-Nucleated Repression Programs Contributes to Breast Cancer Metastasis.
25982273 2016 LASP-1: a nuclear hub for the UHRF1-DNMT1-G9a-Snail1 complex.
25935252 2015 Evidence of a sex-dependent restrictive epigenome in schizophrenia.
25843229 2015 A role for KMT1c in monocyte to dendritic cell differentiation: Epigenetic regulation of monocyte differentiation.
More...