Property Summary

NCBI Gene PubMed Count 35
PubMed Score 18.36
PubTator Score 22.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -1.100 2.4e-06
astrocytic glioma -1.100 1.2e-02
psoriasis -1.300 8.0e-04
glioblastoma -2.700 4.9e-07
osteosarcoma -1.534 4.7e-04
ependymoma -1.600 5.1e-10
atypical teratoid / rhabdoid tumor -2.400 1.9e-10
medulloblastoma -1.500 2.2e-04
medulloblastoma, large-cell -2.500 7.0e-05
primitive neuroectodermal tumor -1.800 6.5e-04
lung cancer -1.300 1.5e-03
adult high grade glioma -2.400 8.6e-07
pilocytic astrocytoma -1.700 5.0e-08

Synonym

Accession Q96KQ4 B2RMX5 O94870
Symbols p85
ASPP1
p53BP2-like

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (20)

PMID Text
26595804 ASPP1/2-PP1 complexes are required for chromosome segregation and kinetochore-microtubule attachments.
25660448 ASPP1/2 interacted with centrosome linker protein C-Nap1. Co-depletion of ASPP1 and ASPP2 inhibited re-association of C-Nap1 with centrosome at the end of mitosis.
24162774 HIV-1 gp120 upregulates the expression of protein phosphatase 1, regulatory subunit 13B (PPP1R13B) in human B cells
23392125 ASPP1 and ASPP2 cooperate with oncogenic RAS to enhance the transcription and apoptotic function of p53.
23088536 When the Px(T)PxR motif is deleted or mutated via insertion of a phosphorylation site mimic (T311D), PP-1c fails to bind to all three ASPP proteins, ASPP1, ASPP2 and iASPP.
22552744 the mRNA expression of ASPP1 and ASPP2 was frequently dowregulated in tumor tissues, and this decreased significantly in samples expressing wild-type p53
22169642 ASPP1 promoter methylation may be associated with the malignant progression of non-small cell lung cancer, and ASPP1 expression promotes cellular apoptosis.
22068052 The ability of ASPP1 to activate YAP results in the decreased expression of LATS2, which lowers the ability of p53 to induce p21, cell-cycle arrest and senescence.
21479363 overexpression of ASPP1 rendered MCF-7 and MDA-MB231 breast cancer cells more sensitive to resveratrol-mediated apoptosis via the E2F pathway
21102414 Suggest that downregulation of ASPP1 by hypermethylation may be involved in the pathogenesis and progress of gestational trophoblastic disease, probably through its effect on apoptosis.
21041411 Data show that ASPP1 enhances nuclear accumulation of YAP/TAZ and YAP/TAZ-dependent transcriptional regulation.
21041410 Data show that Lats2 and ASPP1 shunt p53 to proapoptotic promoters and promote the death of polyploid cells.
20601096 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20034025 ASPP1 and ASPP2 genes are frequently down-regulated by DNA methylation in HBV-positive hepatocellular carcinoma, which may play important roles in the development of HCC
16314841 results demonstrate that decreased expression of ASPP1 in patients with ALL is due to an abnormal methylation of its promoter and is associated with a poor prognosis
16139958 role of ASPP1, ASPP2, and iASPP as apoptotic specific regulators of p53 [review]
15782125 Mdm2 and mdmx prevent ASPP1 and ASPP2 from stimulating the apoptotic function of p53 by binding and inhibiting the transcriptional activity of p53.
15757645 ASPP1 CpG island aberrant methylation could be one molecular and genetic alteration in wild-type p53 tumours.
15731768 target of E2F transcription factor

AA Sequence

MMPMILTVFLSNNEQILTEVPITPETTCRDVVEFCKEPGEGSCHLAEVWRGNERPIPFDHMMYEHLQKWG      1 - 70
PRREEVKFFLRHEDSPTENSEQGGRQTQEQRTQRNVINVPGEKRTENGVGNPRVELTLSELQDMAARQQQ     71 - 140
QIENQQQMLVAKEQRLHFLKQQERRQQQSISENEKLQKLKERVEAQENKLKKIRAMRGQVDYSKIMNGNL    141 - 210
SAEIERFSAMFQEKKQEVQTAILRVDQLSQQLEDLKKGKLNGFQSYNGKLTGPAAVELKRLYQELQIRNQ    211 - 280
LNQEQNSKLQQQKELLNKRNMEVAMMDKRISELRERLYGKKIQLNRVNGTSSPQSPLSTSGRVAAVGPYI    281 - 350
QVPSAGSFPVLGDPIKPQSLSIASNAAHGRSKSANDGNWPTLKQNSSSSVKPVQVAGADWKDPSVEGSVK    351 - 420
QGTVSSQPVPFSALGPTEKPGIEIGKVPPPIPGVGKQLPPSYGTYPSPTPLGPGSTSSLERRKEGSLPRP    421 - 490
SAGLPSRQRPTLLPATGSTPQPGSSQQIQQRISVPPSPTYPPAGPPAFPAGDSKPELPLTVAIRPFLADK    491 - 560
GSRPQSPRKGPQTVNSSSIYSMYLQQATPPKNYQPAAHSALNKSVKAVYGKPVLPSGSTSPSPLPFLHGS    561 - 630
LSTGTPQPQPPSESTEKEPEQDGPAAPADGSTVESLPRPLSPTKLTPIVHSPLRYQSDADLEALRRKLAN    631 - 700
APRPLKKRSSITEPEGPGGPNIQKLLYQRFNTLAGGMEGTPFYQPSPSQDFMGTLADVDNGNTNANGNLE    701 - 770
ELPPAQPTAPLPAEPAPSSDANDNELPSPEPEELICPQTTHQTAEPAEDNNNNVATVPTTEQIPSPVAEA    771 - 840
PSPGEEQVPPAPLPPASHPPATSTNKRTNLKKPNSERTGHGLRVRFNPLALLLDASLEGEFDLVQRIIYE    841 - 910
VEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNAADSDGWTPLHCAASCNSVHLCKQLVESGAAI    911 - 980
FASTISDIETAADKCEEMEEGYIQCSQFLYGVQEKLGVMNKGVAYALWDYEAQNSDELSFHEGDALTILR    981 - 1050
RKDESETEWWWARLGDREGYVPKNLLGLYPRIKPRQRTLA                                 1051 - 1090
//

Text Mined References (40)

PMID Year Title
26595804 2015 ASPP1/2-PP1 complexes are required for chromosome segregation and kinetochore-microtubule attachments.
26201719 2015 Identification of novel target genes specifically activated by deregulated E2F in human normal fibroblasts.
25660448 2015 The tumor suppressor proteins ASPP1 and ASPP2 interact with C-Nap1 and regulate centrosome linker reassembly.
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23392125 2013 ASPP1 and ASPP2 bind active RAS, potentiate RAS signalling and enhance p53 activity in cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23088536 2013 Molecular mechanisms underlying the interaction of protein phosphatase-1c with ASPP proteins.
22552744 2012 Abnormal expression pattern of the ASPP family of proteins in human non-small cell lung cancer and regulatory functions on apoptosis through p53 by iASPP.
22321011 Protein phosphatase 1? interacting proteins in the human brain.
22169642 2011 [Promoter methylation of ASPP1 and ASPP2 genes in non-small cell lung cancers].
22068052 2012 An indirect role for ASPP1 in limiting p53-dependent p21 expression and cellular senescence.
21998301 2011 Inhibitory member of the apoptosis-stimulating proteins of the p53 family (iASPP) interacts with protein phosphatase 1 via a noncanonical binding motif.
21513714 2011 The ASPP proteins complex and cooperate with p300 to modulate the transcriptional activity of p53.
21479363 2011 Resveratrol induces apoptosis in breast cancer cells by E2F1-mediated up-regulation of ASPP1.
21102414 2011 Downregulation of ASPP1 in gestational trophoblastic disease: correlation with hypermethylation, apoptotic activity and clinical outcome.
21041411 2010 Cytoplasmic ASPP1 inhibits apoptosis through the control of YAP.
21041410 2010 The Lats2 tumor suppressor augments p53-mediated apoptosis by promoting the nuclear proapoptotic function of ASPP1.
20601096 2010 Single-nucleotide polymorphisms in DNA-repair genes and cutaneous melanoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20034025 2010 Epigenetic silence of ankyrin-repeat-containing, SH3-domain-containing, and proline-rich-region- containing protein 1 (ASPP1) and ASPP2 genes promotes tumor growth in hepatitis B virus-positive hepatocellular carcinoma.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17043677 2007 Disrupted in Schizophrenia 1 Interactome: evidence for the close connectivity of risk genes and a potential synaptic basis for schizophrenia.
16314841 2006 ASPP1, a common activator of TP53, is inactivated by aberrant methylation of its promoter in acute lymphoblastic leukemia.
16139958 2005 ASPP--Apoptotic specific regulator of p53.
15782125 2005 Mdm2 and mdmX prevent ASPP1 and ASPP2 from stimulating p53 without targeting p53 for degradation.
15757645 2005 Downregulated mRNA expression of ASPP and the hypermethylation of the 5'-untranslated region in cancer cell lines retaining wild-type p53.
15731768 2005 ASPP1 and ASPP2 are new transcriptional targets of E2F.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14729977 2004 ASPP1 and ASPP2: common activators of p53 family members.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11684014 2001 ASPP proteins specifically stimulate the apoptotic function of p53.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.