Property Summary

NCBI Gene PubMed Count 35
PubMed Score 18.36
PubTator Score 22.63

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.85237357227015E-10
ependymoma 2514 5.14083929655737E-10
pilocytic astrocytoma 3086 4.98013917038387E-8
glioblastoma 5572 4.90480529220817E-7
adult high grade glioma 2148 8.64581613969262E-7
malignant mesothelioma 3163 2.38679919717419E-6
medulloblastoma, large-cell 6234 7.03650762692624E-5
medulloblastoma 1524 2.21285400040318E-4
osteosarcoma 7933 4.67398079570732E-4
primitive neuroectodermal tumor 3031 6.52562069689008E-4
psoriasis 6685 7.95500270430271E-4
lung cancer 4473 0.00151825222922909
astrocytic glioma 2241 0.0116746328306199


  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
astrocytic glioma -1.100 0.012
psoriasis -1.300 0.001
glioblastoma -2.700 0.000
osteosarcoma -1.534 0.000
ependymoma -1.600 0.000
atypical teratoid / rhabdoid tumor -2.400 0.000
medulloblastoma -1.500 0.000
medulloblastoma, large-cell -2.500 0.000
primitive neuroectodermal tumor -1.800 0.001
lung cancer -1.300 0.002
adult high grade glioma -2.400 0.000
pilocytic astrocytoma -1.700 0.000


Accession Q96KQ4 B2RMX5 O94870
Symbols p85


PANTHER Protein Class (1)

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

 GWAS Trait (1)

Gene RIF (20)

26595804 ASPP1/2-PP1 complexes are required for chromosome segregation and kinetochore-microtubule attachments.
25660448 ASPP1/2 interacted with centrosome linker protein C-Nap1. Co-depletion of ASPP1 and ASPP2 inhibited re-association of C-Nap1 with centrosome at the end of mitosis.
24162774 HIV-1 gp120 upregulates the expression of protein phosphatase 1, regulatory subunit 13B (PPP1R13B) in human B cells
23392125 ASPP1 and ASPP2 cooperate with oncogenic RAS to enhance the transcription and apoptotic function of p53.
23088536 When the Px(T)PxR motif is deleted or mutated via insertion of a phosphorylation site mimic (T311D), PP-1c fails to bind to all three ASPP proteins, ASPP1, ASPP2 and iASPP.
22552744 the mRNA expression of ASPP1 and ASPP2 was frequently dowregulated in tumor tissues, and this decreased significantly in samples expressing wild-type p53
22169642 ASPP1 promoter methylation may be associated with the malignant progression of non-small cell lung cancer, and ASPP1 expression promotes cellular apoptosis.
22068052 The ability of ASPP1 to activate YAP results in the decreased expression of LATS2, which lowers the ability of p53 to induce p21, cell-cycle arrest and senescence.
21479363 overexpression of ASPP1 rendered MCF-7 and MDA-MB231 breast cancer cells more sensitive to resveratrol-mediated apoptosis via the E2F pathway
21102414 Suggest that downregulation of ASPP1 by hypermethylation may be involved in the pathogenesis and progress of gestational trophoblastic disease, probably through its effect on apoptosis.

AA Sequence

RKDESETEWWWARLGDREGYVPKNLLGLYPRIKPRQRTLA                                 1051 - 1090

Text Mined References (40)

PMID Year Title
26595804 2015 ASPP1/2-PP1 complexes are required for chromosome segregation and kinetochore-microtubule attachments.
26201719 2015 Identification of novel target genes specifically activated by deregulated E2F in human normal fibroblasts.
25660448 2015 The tumor suppressor proteins ASPP1 and ASPP2 interact with C-Nap1 and regulate centrosome linker reassembly.
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23392125 2013 ASPP1 and ASPP2 bind active RAS, potentiate RAS signalling and enhance p53 activity in cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23088536 2013 Molecular mechanisms underlying the interaction of protein phosphatase-1c with ASPP proteins.