Property Summary

NCBI Gene PubMed Count 16
PubMed Score 43.46
PubTator Score 161.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -2.400 0.000
tuberculosis -2.400 0.000
lung cancer -1.800 0.004
active Crohn's disease 3.313 0.011
psoriasis 7.100 0.000
lung carcinoma -1.600 0.001
ulcerative colitis 5.100 0.000

Gene RIF (10)

PMID Text
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of TNFAIP3 interacting protein 3 (TNIP3) in peptide-treated PBMCs
22093807 recombinant transgene facilitates the transcription of pro-inflammatory cytokines in fibroblast-like synoviocytes in rheumatoid arthritis
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19617629 adiponectin augmented the expression of A20, suppressor of cytokine signaling (SOCS) 3, B-cell CLL/lymphoma (BCL) 3, TNF receptor-associated factor (TRAF) 1, and TNFAIP3-interacting protein (TNIP) 3.
19464428 This review defines ABIN-3 based on three different parameters: ability to bind A20; ability to inhibit NF-kappaB activation upon overexpression; the presence of specific short amino acid regions of strong homology, designated ABIN homology domains.
18081698 Enhanced expression of ABIN-3 in monocytes is associated with sepsis
17485448 ABIN-3 is, thus, an IL-10-induced gene product capable of attenuating NF-kappaB in human macrophages yet is inoperative in mice and represents a basis for species-specific differences in IL-10 actions.
17088249 ABIN-3 is a novel negative feedback regulator of LPS-induced NF-kappaB activation

AA Sequence

MAHFVQGTSRMIAAESSTEHKECAEPSTRKNLMNSLEQKIRCLEKQRKELLEVNQQWDQQFRSMKELYER      1 - 70
KVAELKTKLDAAERFLSTREKDPHQRQRKDDRQREDDRQRDLTRDRLQREEKEKERLNEELHELKEENKL     71 - 140
LKGKNTLANKEKEHYECEIKRLNKALQDALNIKCSFSEDCLRKSRVEFCHEEMRTEMEVLKQQVQIYEED    141 - 210
FKKERSDRERLNQEKEELQQINETSQSQLNRLNSQIKACQMEKEKLEKQLKQMYCPPCNCGLVFHLQDPW    211 - 280
VPTGPGAVQKQREHPPDYQWYALDQLPPDVQHKANGLSSVKKVHP                             281 - 325
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23468962 2013 A genome-wide scan for breast cancer risk haplotypes among African American women.
22093807 2012 A pro-inflammatory role for A20 and ABIN family proteins in human fibroblast-like synoviocytes in rheumatoid arthritis.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19617629 2009 Adiponectin inhibits pro-inflammatory signaling in human macrophages independent of interleukin-10.
19464428 2009 ABINs: A20 binding inhibitors of NF-kappa B and apoptosis signaling.
18212736 2008 Ubiquitin binding mediates the NF-kappaB inhibitory potential of ABIN proteins.
18081698 Expression of the NF-kappaB inhibitor ABIN-3 in response to TNF and toll-like receptor 4 stimulation is itself regulated by NF-kappaB.
More...