Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.58
PubTator Score 1.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 0.000

Gene RIF (3)

PMID Text
24096827 Connexin40 regulates platelet function.
22729648 The data show that induced expression of either Cx37 or Cx40 in Cx43-expressing cells can selectively alter the intercellular exchange of some molecules without affecting the transfer of others.
12881038 expression patterns differ from mouse orthologs [Cx30.2; Cx40.1]

AA Sequence

MEGVDLLGFLIITLNCNVTMVGKLWFVLTMLLRMLVIVLAGRPVYQDEQERFVCNTLQPGCANVCYDVFS      1 - 70
PVSHLRFWLIQGVCVLLPSAVFSVYVLHRGATLAALGPRRCPDPREPASGQRRCPRPFGERGGLQVPDFS     71 - 140
AGYIIHLLLRTLLEAAFGALHYFLFGFLAPKKFPCTRPPCTGVVDCYVSRPTEKSLLMLFLWAVSALSFL    141 - 210
LGLADLVCSLRRRMRRRPGPPTSPSIRKQSGASGHAEGRRTDEEGGREEEGAPAPPGARAGGEGAGSPRR    211 - 280
TSRVSGHTKIPDEDESEVTSSASEKLGRQPRGRPHREAAQDPRGSGSEEQPSAAPSRLAAPPSCSSLQPP    281 - 350
DPPASSSGAPHLRARKSEWV                                                      351 - 370
//

Text Mined References (8)

PMID Year Title
24096827 2013 Connexin40 regulates platelet function.
22729648 2012 Inducible coexpression of connexin37 or connexin40 with connexin43 selectively affects intercellular molecular transfer.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12881038 Expression profiles of the novel human connexin genes hCx30.2, hCx40.1, and hCx62 differ from their putative mouse orthologues.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12108537 2002 Structural and functional diversity of connexin genes in the mouse and human genome.